SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006614 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006614
Domain Number 1 Region: 178-416
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.19e-69
Family Eukaryotic proteases 0.00024
Further Details:      
 
Domain Number 2 Region: 37-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000511
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 72-173
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000419
Family Hepsin, N-terminal domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006614   Gene: ENSMEUG00000007247   Transcript: ENSMEUT00000007266
Sequence length 417
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_6583:4301:33860:-1 gene:ENSMEUG00000007247 transcript:ENSMEUT00000007266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADALAAQILSLLPLKFFPIIVIGIIALIIAVAIGLGIHFNCSGKYRCRSSFQCIELTARC
DGVYNCKDGEDEYRCVRVSGHNAVLQVFVAAAWRTMCSDDWKGQYGLIACEQLGFSXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKCSSGRVIILKCVXXXXXXX
XXXXXVGGNMSSLMQWPWQVSLQFQGYHLCGGSLITPVWIVTAAHCVYDLYMPSSWTIQV
GLVTLIDTPAPSYSVEKIIYHSKYKPKRLGNDIALMKLAEPLTFNXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXGDASPVLNHAAVPLISNKVCNHKDVYGGIIAPSMLCAGYLKG
GVDSCQGDSGGPLVCEEMRIWKLVGATSFGIGCADVNKPGVYTRITSFLDWIHEQME
Download sequence
Identical sequences ENSMEUP00000006614 ENSMEUP00000006614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]