SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007642 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007642
Domain Number 1 Region: 77-160
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 348-401
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000377
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0099
Further Details:      
 
Domain Number 3 Region: 159-213,240-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000475
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007642   Gene: ENSMEUG00000008354   Transcript: ENSMEUT00000008380
Sequence length 697
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5334:2722:142125:1 gene:ENSMEUG00000008354 transcript:ENSMEUT00000008380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRPAPSPPSSWSKMATPAAVNPSEMASDIPGSVTLPVAPMATGQVRMTGAMPARGGKRRS
GMDFDDEDGEGPSKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRM
AVSHMKSMRGTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVT
PVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMR
MCMGSRRSFICRMRCGNAPLDHLPLNRITTMRKRYXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXMTIPEEDADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPAEFLSRHNSEGIIT
FVDPRCISVIGYQPQDLLGKDILEFCHPEDQSHLRESFQQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQQQQAELEVHQRDGLSSYDLSQVPVPN
IPANVHETGKPVEKADAIFSQERDPRFAEMFAGITASEKKMMSSASAAGNQQLYSQGSPF
QPGHSGKAFSSSVVHVPGVNDIQSSSSTGQNMTQISRQINQSQVAWTGSRPPFPGQQIPS
QSSKTQSSPFGIGTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTSGFAESGQSSGQ
FQGRPSEVWSQWQSQHPNQQSSDQHSHQQPSQTEVFQ
Download sequence
Identical sequences ENSMEUP00000007642 ENSMEUP00000007642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]