SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008133 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008133
Domain Number 1 Region: 221-311
Classification Level Classification E-value
Superfamily Immunoglobulin 5.44e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000208
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008133   Gene: ENSMEUG00000008905   Transcript: ENSMEUT00000008928
Sequence length 344
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8750:8276:106330:1 gene:ENSMEUG00000008905 transcript:ENSMEUT00000008928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTIQAKMHNSISWAIFAGLAALFLFQGVPVRSGDATFPKAMDNVTVRQGESATLRCTVD
NRVTRVAWLNRSTILYAGNDKWCLDPRVVLLTNTKTQYSIEIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPYISEAKSTGVAVGQKGT
LQCEASAVPSAEFQWYKDDKRLVGGQKRVKVENRPFLSKLIFFNVSEHDYGNYTCVASNN
LGHTNASITLFAPGAVSEVNNGTSRRAGCIWLLPLLILHLLLKF
Download sequence
Identical sequences ENSMEUP00000008133 ENSMEUP00000008133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]