SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008426 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008426
Domain Number 1 Region: 345-476
Classification Level Classification E-value
Superfamily Sema domain 2.75e-36
Family Sema domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 235-296
Classification Level Classification E-value
Superfamily Sema domain 1.09e-21
Family Sema domain 0.00047
Further Details:      
 
Domain Number 3 Region: 472-525
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000349
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 4-75
Classification Level Classification E-value
Superfamily Sema domain 0.0000000000445
Family Sema domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000008426
Domain Number - Region: 543-592
Classification Level Classification E-value
Superfamily Immunoglobulin 0.019
Family C1 set domains (antibody constant domain-like) 0.025
Further Details:      
 
Domain Number - Region: 123-145
Classification Level Classification E-value
Superfamily Sema domain 0.0759
Family Sema domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008426   Gene: ENSMEUG00000009223   Transcript: ENSMEUT00000009251
Sequence length 624
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8977:9343:17437:1 gene:ENSMEUG00000009223 transcript:ENSMEUT00000009251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQERTVWRFEAEGITNYTALLLSRDGQTLFVGAREALFALNSSSSFLPGGHYQKLPWSAD
LDKKRQCVFKGKDSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIQNFSLERDGA
GNVLLEDGKGRCPFDPEYKSTAIMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDLGGE
RVLQRRWTSFLKAQLLCSRPSDGFPFNVLQDVFVLSPSPKNWQDTLFYGVFTSQXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCITNSAREKRINSSL
QLPDRVLNFLKDHFLMDKQVRSNPLLLQTRARYQRLSVHRVPGLHRTYDVLFLGTSDGRL
HKTVSSRQRVHIIEEIQLFPPGHPVQNLLLDPQRGLLYAASYSAVVQVSVANCSLYTSCG
ECILSRDPYCAWSGTSCRDVRHYQPELGSRPWVQDIEDANTKQLCNNSAFGRKPTTLSSK
TPCKQVHFLPNTVNTLTCRLLSNLASRRWVHNKAPINNSASYRVLPSGDLLLVGSQDGLG
SFQCWSLEENFQQLVANYCVEATE
Download sequence
Identical sequences ENSMEUP00000008426 ENSMEUP00000008426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]