SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008524 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008524
Domain Number 1 Region: 324-414
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000301
Family I set domains 0.006
Further Details:      
 
Domain Number 2 Region: 12-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000145
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008524   Gene: ENSMEUG00000009339   Transcript: ENSMEUT00000009365
Sequence length 443
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_3119:295:71114:1 gene:ENSMEUG00000009339 transcript:ENSMEUT00000009365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLTVSIEPLPPVVVGDAVTLKCNFKTDGRMREIVWYRVTDGGTIKQKIFTFDAMFSTNSS
HMENYRKREDLVYQSTVRLPEVRISDNGPYECHVGIYDRATREKVVLASGNIFLNVMXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXAPKGPKIMMTPARARVGDTVRILVHGFQNEVFPEPLFTWTRVGSR
LLDGSTEHDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGTEDSN
GSSDPGPARLTWVFALTVILELT
Download sequence
Identical sequences ENSMEUP00000008524 ENSMEUP00000008524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]