SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008549 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008549
Domain Number 1 Region: 216-393
Classification Level Classification E-value
Superfamily MIR domain 4.45e-47
Family MIR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 657-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000427
Family SPRY domain 0.033
Further Details:      
 
Domain Number 3 Region: 102-186
Classification Level Classification E-value
Superfamily MIR domain 0.00000876
Family MIR domain 0.028
Further Details:      
 
Domain Number 4 Region: 4002-4080
Classification Level Classification E-value
Superfamily EF-hand 0.0000125
Family Calmodulin-like 0.039
Further Details:      
 
Domain Number 5 Region: 2185-2255
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000144
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 6 Region: 441-550
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000157
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 7 Region: 1129-1197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000229
Family SPRY domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008549   Gene: ENSMEUG00000009236   Transcript: ENSMEUT00000009394
Sequence length 4956
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9397:3977:88002:1 gene:ENSMEUG00000009236 transcript:ENSMEUT00000009394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGEGEDDVQFLRTEDEVVLQCSATTLKEQIKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAVCCFMLEQSLSVRALQEMLANTVEAGTESSQGGGHRTLLYGHAILLRHTHSRMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQADASFMQTLWNMNPICSGCEEGYVTGGHVLRLFHGHMDECLTISPADSDD
QRRLVHYEGGAVCTHARSLWRLEPLRISWSGSHLRWGQPLRVRHVTTGRYLALTEDQGLV
VVDASKAATKATAFCFRISKEKLDTAPKRDIEGMGPPEIKYGESLCFVQHVASGLWLTYA
APDPKALRLGLMKRKAMLHQEGHMDDALSLTRCQLEESQAARMIYSTAGLYNQFIKGLDS
LSGKPKGAPAPGVTLPIEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQEE
GMLSLVLNCIDRLNVYSTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALFS
HNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQVLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYGK
WYFEVMVDSVEPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDXXXX
XXXRVARPVASPGQHLLAAEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVV
SFSAGIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNK
RLHPCLVDFHSLPEPERNYNLQMSGETLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMM
SNRYKPAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVGQGWSYSSVQDISARXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQRWHMGSEPFG
RPWQPGDVVGCMIDLTENTILFTLNGEVLMSDSGSETAFRDIEIGDGFLPVCSLGLGQVG
RLNLGQDVGSLRYFTICGLQEGFEPFAINMQRPVTIWFSKSLPQFEPMPPDHPHYEVTRV
DGTVDTPPCLRLTHRTWGSQNSLVEMMFLRLSLPVQFYQHFRCTPGATPLAPPGPQPPGD
DEVRAAEPDPDYEQLQRSAGRTGEAEGNKEGNGGPPKKGXXXXXXXXXXXXXXXXXXXXX
XXFLFKAKKAAMMSQPPATPTLPRLPHDVVPADNRDDPEIILNTTTYYYSVRVFAGQEPS
SVWVGWVTPDYHQHDMNFELSKVRAVTVTMGDERGNVHNXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEPNTKLFPAAFVLPTNQNVIQFEL
GKLKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPVSWSRMPNHFLQVETHRAGDRLGW
AVQCEDPLTMMALHIPEENRCMDILELSERLSLQRFHSHTLNLYRAVCALGNNRVAHALC
SHVDQAQLLHAIEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLNEYIVPLTPETSTIT
LFPPGLSGEESPRHHGLPGVGASTSLRPPLHFSPPCFVAALVGAGSAEAPARFSPSIPLE
VLRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSNLLVMGVFGDEDVKQILRM
IEPEVFKEEEEEEEEDEEEKEEDEEEEEEKEEEEKEEENEEEEEREKGEAVEEGLLQMKL
PESVKLQMCHLLEYFCDQELQHRVEALIAFSERYVHRLQGNQRSRYGLLMRAFTMSAAET
ARRTREFRSPPQEQINMLLHFKGGEDEEDCPVPDEVRQELLDFHQDLLLHCGIQLAGEEE
EVEEETTLGGRLMNFLEKVKLVKKKEEEPDETPAPEEKKPESLQELVSHTMVRWAQEDFI
QNPELVRAMFSLLHRQYDGLGELLRAMPRAYTISPSSVEDTMSLLECLCQIRSLLIVQMG
PQEEHLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTS
CCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQ
EQDLDKVVSYLAGCGLQSCRMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENAN
VVVRLLIRRPECFGPALRGEGGSGLLAAMEEAIRISEDPARDGPGVRKDRRRDGEDAPEE
NRVHLGNAIMSFYSALIDLLGRCAPETHLIQAGKGEALRIRAILRSLVPLDDLVGIISLP
LQIPTLGKDGALVQPRMSASFVPDHKAPMVLFLDRVYGIDSQDFLLHVLDVGFLPDMRAA
ASLDTATFSTTEMALALNRYLCTAVLPLITKCAPLFAGTEHRAIMVDSMLHTVYRLSRGR
SLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERCWK
YYCLPTGWANYGVTSEEELHLTRKLFWGIFESLAHKVFASXXXXGVKAGAEGIPNPVIIP
EKLDSFINKFAEYTHEKWAFDKIQNNWTFGENIDEELKTHHMLRPYKTFSEKDKEIYRWP
IKESLKAMIAWEWTVEKAREGEEEKAEKKTKTRKISQNATYDPREGYNPQPPDLSCVTLS
RELQAMAEQLAENYHNTWGRKKKQELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLK
FLQMNGYAVTRGLKDMELDTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEK
SPHEQEIKFFAKILLPLINQYFHNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAA
LVRHRVSLFXXXXXXXXXXXXXXXXXXXXXTVMKSGPEIVKAGLRSFFESASEDIEKMVE
NLRLGKVSQARTQVKGVGQNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRT
LCSIYSLGTTKNSYVEKLRPALGECLARLAAAMPVAFLEPQLNEFNVCSVYTTKSPRERA
ILGLPSSVEEMCPDIPDLKQLMAEIGGLAESGARYTEMPHVIEVTLPMLCNYLPRWWERG
PEVPTSQTPGGPPPCTDVTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRA
TPEMLRSHFIPTVGRLRKRAGKVVAEEEQLRLEAKAEAEEGEVLVREEFSVLCRDLYALY
PLLIRYVDNNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXAGDGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKDTDEEVREFLQNNLHLQGKSEGSPSLRWQMALYRGLPGRAEDADAP
DKIVRRVQEVSAVLFHLEQTEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPRHRA
SNMFLESYKAAWILTEEHSFEDRMIHDLSKAGEEERGETRGKEPDPLHQLVLHFSRTALT
EKSKLDEDYLYMAYADIMAKSCHLNEGEEPSEPAEEEVEASFEEKEMEKQKLLYQQSRLH
NRGAAEMVLQMISACKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLKDKKEVGFFQS
IQALMQTCSVLDLNAFERQNKAEGLGMVTEEGTVINRQNGEKVMADDEFTQDLFRFLQLL
CEGHNNDFQNYLRTQTGNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIDEQGKRNF
SKAMAVAKQVFNSLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHFAHMMMKLAQDSSQIEL
LKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILKFFDMFLKLKDIV
GSEAFQDYVTDPRGLISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINVEEFASRF
QEPAREIGFNVAVLLTNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGSSRRIER
IYFEISETNKTQWEMPVKESKRQFIFDVVNEGGESEKMEMFVSFCEDTIFEMQIAAQISE
PEGEPEEDEDESAPESGPDATEAGPDGEGTTAAGISGHVVGAVSSILRRLTYRSLRRRVR
RLRRLTVREAASAGAGFIWSGVTWTGTGVIGATRGALSLLWGSLFGGGLVEAKVTVTGLL
AGMPDPSDEVHGEQATGAGWDVEGEGDSDSAGDGAVEGDGDRGEAEVEAGLGRAGGEGAG
ADGGHFRMEVPGGLGDMGDTTPVEPPTPEGSPIFRRKLGAENGEKEGAQEPAPEAPKKAA
APSPPRKEESKSEGPDFWEELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFILLFYKVS
DSPPGEEGLEGSGFEGLAGSGSGDFLGSGMGSGAGDEMEDEEEENMVYYFLEESTGYMEP
ALRGLSILHTLIAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDDVKGQW
DRLVLNTPSFPSNYWDKFVKRKVLEKHGDIFGRERIAELLGMDLASLEITAQNEKRPEPP
PGLLTWIMSIDVKYQIWKFGVIFTDNSFLYLTWYMVMSLLGHYNNFFFAAHLLDIAMGVK
TLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMT
CYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLIIDAFG
ELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDET
EHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLA
Download sequence
Identical sequences ENSMEUP00000008549 ENSMEUP00000008549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]