SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009316 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009316
Domain Number 1 Region: 180-295
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000235
Family SH2 domain 0.0022
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000224
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009316   Gene: ENSMEUG00000010221   Transcript: ENSMEUT00000010245
Sequence length 330
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold374:46361:56248:-1 gene:ENSMEUG00000010221 transcript:ENSMEUT00000010245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHALKRILYSTWCPAECQFAFISRNPRSPASKLFCHLFVGSQPGEVQILHLLLCRSFQL
SYLLQHPEDQARPGPGTPAEESPKPLPSPIGPAGVVREPFGRDQVSQNVHALVSFRRLPK
EMSEAEGRGATRHSRLGNPYCSPTLVRKKAIRSKVIRSGAYRCCTYETQLQQSAREAFPS
AWESWAQGASGLVCLVESEGSLTENIWAFAGLSRARALSLLRRDVLGAFLLWPEPGPSGQ
WCLSVKTQCGVVPHQVFRTHLGKFSVEHLPTEFPSLEALVEHHSGAERSLFCPLDMGRLN
PCYEAQDCAPGRPMWPRSHPKHEPRQQELG
Download sequence
Identical sequences ENSMEUP00000009316 ENSMEUP00000009316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]