SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009845 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009845
Domain Number 1 Region: 48-123
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 138-180
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000209
Family Hairy Orange domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009845   Gene: ENSMEUG00000010801   Transcript: ENSMEUT00000010823
Sequence length 410
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_4325:388:4535:1 gene:ENSMEUG00000010801 transcript:ENSMEUT00000010823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERITSAQPPPDCLGKVPGLEPSEMAGMDFAHMYQVYKPRGLKRSEDNKETYKLPHRLIE
KKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIEQQQQKIMSL
QSGLQAGELSSRNLDAGQEMFCSGFQMCAREVLQYLAKHESSRDVKSSQLVSHLHRMVSE
VLQGGVVHKPGDPTPKMMDFKEKPSSLTKGTEGHGKNCVPVIQRTFAHSSGEQSGSDTDT
DSGYGGELEKSDSKTDQQYFKNDNERKYPLGERVSTIKQESEDPPAKKTRLDMSDRESHF
SSDLIGSSFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLPASATAL
TGFMNPEKIPPPLLMPQRLPSPLPSHSSIDSSALLQALKQIPPLNLETKD
Download sequence
Identical sequences ENSMEUP00000009845 ENSMEUP00000009845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]