SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010075 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010075
Domain Number 1 Region: 408-607
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-43
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 2-35,160-192
Classification Level Classification E-value
Superfamily RING/U-box 3.71e-16
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 201-253
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000321
Family B-box zinc-binding domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010075   Gene: ENSMEUG00000011043   Transcript: ENSMEUT00000011077
Sequence length 610
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5576:1882:13411:1 gene:ENSMEUG00000011043 transcript:ENSMEUT00000011077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVCAICLDYFTDPVSMGCGHNFCRVCVTQLWGGEDEEEREEEEDEGEEEEVEAVGASGG
WDTPMREDEYEGDMEEEEVEEEEDEEFWTNSINGPTWDNMDYVWDEEEEEDLDYYLGDVE
EELRGEEEEEDEDEEVLEEDEEEELEPATPPPPTPAPRRRFTCPQCRKTFPRRSFRPNLQ
LANMVQVIRQMHPAPRRGSRGNEQGVCPKHQEALKLFCEVDEEAICVVCRESRNHKQHSV
VPLEEVVQEYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
DIKETFNRCEEVQLQPLEIWSPDPSHPHSHDFLTDAIVRKMSRMFCQAARVDLTLDPDTA
HPALALSPDRRGVRLAERRQELPDHSKRFPTECCVLGAQGFRSGRHYWEVEVGGRRGWAV
GAARESTRHKEKGGPGSSGGGSGDATPSRHHHRRRMPHLPQQPMFQREVWCVGTNGKRYQ
AXXXXXXXXXXXXXXXXXXXVYLDYEAGRLGFYNAETLGHVHTFSAAFLGERVFPFFRVI
SKGTRIKLCP
Download sequence
Identical sequences ENSMEUP00000010075 ENSMEUP00000010075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]