SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010536 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010536
Domain Number 1 Region: 384-495
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.7e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 225-305
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.05e-24
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010536   Gene: ENSMEUG00000011550   Transcript: ENSMEUT00000011587
Sequence length 507
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2181:5154:31764:-1 gene:ENSMEUG00000011550 transcript:ENSMEUT00000011587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSQPQQQPPPRRVTNVGSLLLTPQENEALFGFLGKKCVXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNLPMATVDIKNPEITTNRFYGPQV
NNISHNKEKKKGKTKKKRLTKADIGTPSNFXXXXXXXXXXXXXXXLNNLDPELKNLFDMC
GISEAQLKDKETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPPHSSG
PPPPPARGRGAPPPPPSRAPTAAPPPPPSRPGVTVPPPPPNRMYPPPPPAHPSSAPSGPP
PPPPPLSVAGSAAPPPPPPPPPPPPGPPPPPGPSSDGDHQLAAPAGNKAALLDQIREGAQ
LKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGQDSVPPTPAPTSGIVGALMEVMQKR
SKAIHSSDEDEDEDDEEDFEDDDEWDD
Download sequence
Identical sequences ENSMEUP00000010536 ENSMEUP00000010536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]