SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011828 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011828
Domain Number 1 Region: 332-421
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.11e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 158-210
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000854
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 53-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000877
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011828   Gene: ENSMEUG00000012966   Transcript: ENSMEUT00000013007
Sequence length 938
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_5921:124:205928:1 gene:ENSMEUG00000012966 transcript:ENSMEUT00000013007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTKPSFQQDPSRRERITVQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSE
TPEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIHITGRLRLRVSLSH
GRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVD
IVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDNSGKAKDNEN
SKSDEKGNQSENSEDPESDRKKSGHQSDNEMNCNDDGNSSSNQDSRDSDDSFENSDFETQ
KATEDSFGTLGSMQIKVERYVESETDLRLQNCESLTSDSAKDSDSAGEASAQSSSKHQKR
KKRRKKQKGGSLSRRRLSSTSSPNGLDGALVDPPQLLSSPNSASVLKIKTEISEPINFDN
DSSIWNYPPNREISRNESPYSMTKPPSSEHFPSPQASSGGGGGGGRRPGAIPDSVLTPPG
TENTASRKSQFSTSSNSALAPVSSDPLSPPLSASPRDKHPGGGGGGGGVGGGGGGGGGGG
GPGTSSNSLLYTGDLEALQRLQAGNVVLPLVHRVTGTLSATSTAAQRVYTTGTIRYAPAE
VTLAMQGNLLPNTHAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGSAVSGASLT
QMPAGNVFTTAEGLFSTLPFPVYSNGIHTTQTLERKED
Download sequence
Identical sequences ENSMEUP00000011828 ENSMEUP00000011828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]