SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012316 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012316
Domain Number 1 Region: 257-449
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.49e-35
Family BAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 26-148
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.3e-23
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 586-660
Classification Level Classification E-value
Superfamily SH3-domain 1.01e-18
Family SH3-domain 0.00061
Further Details:      
 
Domain Number 4 Region: 497-571
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000199
Family SH3-domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012316   Gene: ENSMEUG00000013505   Transcript: ENSMEUT00000013546
Sequence length 663
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_8793:9615:63194:1 gene:ENSMEUG00000013505 transcript:ENSMEUT00000013546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYQEEEPLSWSGDESQGDEAIGILEKMKQNQRLAAKELVSTEAKYVHYIQLCASDLRN
QLHELPEGDLDVIFSNINDIIKVNSRFLKGLEEAESDEQLVCLLGNLFLEFQEEMESTYK
EYCASYDQALVLVESYKKVPTLQKAIQDVITALVXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKYSKLEHLTVREKLARIN
THSISKKTLRLSQLFKQEAGIVTRTEDREFDDLEEKFNRVASCVSDLKSNVASYLENLET
FLRIKPHECDLEMEGGPVQQYCCLTRNLHLLVFLEFKQRMERLVYHPLDHLSKALLGPQN
LIKKRLDKLLDFERIEEKLSEMGSMTYEEEATRHTYQALNSLLVSELPQFNQVATQWLGQ
ILHTLMALQRDLAQQVLQRAEGELAQLPHSHVSESDFRRLVEDTLGKTSAQLHSFRQSFE
KVLPVPVTQPLQPAAERQVQTLLSKYGPSKLYQVTSNISGSGNLALTLQRGQVVALLQDR
DTKGNTSRWLVDTGGYRGYVPAGKLAPYQVVPPEESRMQAGSGDGFRFPPAEAPVVAAYP
FVARSSHEVSLQAGQPVTILERQDKKGNPEWSLVEVNGQRGYVPSNFLVHIPSPAPWGWS
LPT
Download sequence
Identical sequences ENSMEUP00000012316 ENSMEUP00000012316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]