SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012497 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012497
Domain Number 1 Region: 28-54,99-143
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000178
Family HLH, helix-loop-helix DNA-binding domain 0.0047
Further Details:      
 
Domain Number 2 Region: 138-181
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000034
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012497   Gene: ENSMEUG00000013701   Transcript: ENSMEUT00000013738
Sequence length 299
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9235:400:3034:1 gene:ENSMEUG00000013701 transcript:ENSMEUT00000013738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKVSWSSSGPCALVLEASRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSLRSGKLEKAEILEMTVQYLRA
LHSADSPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQS
KARLVTEPVFPSLGSLPETDFSYQLHPAGPEYPGHSPSEASVFHQGPSHGPFSWPHGPAR
SPTLPYLPNTPVALSNPTQPHSPFLAPVQGLDRHYLNLIGHSHPNTLNHLHTPQHAPVL
Download sequence
Identical sequences ENSMEUP00000012497 ENSMEUP00000012497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]