SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013829 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013829
Domain Number 1 Region: 496-797
Classification Level Classification E-value
Superfamily L domain-like 3.06e-46
Family Ngr ectodomain-like 0.0066
Further Details:      
 
Domain Number 2 Region: 41-434
Classification Level Classification E-value
Superfamily L domain-like 5.1e-36
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 885-1041
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.62e-34
Family Toll/Interleukin receptor TIR domain 0.000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013829   Gene: ENSMEUG00000015154   Transcript: ENSMEUT00000015193
Sequence length 1052
Comment pep:known_by_projection scaffold:Meug_1.0:Scaffold28497:10375:13566:1 gene:ENSMEUG00000015154 transcript:ENSMEUT00000015193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFLMRELYRPFLILFHLFLWYKLPGARWFPKTLPCNVTQNIMEASVMVNCTNQRLTEIPK
GIPYNTTNLTLTINHIPQISPNSFDGLKNLVEIDFRCNCVPVRLGSKDHICTKSPNIDVG
SFRNLTNLKSLYLDANQLSEIPLGLPSSLQLLSLEANHIFSITKENLTELDNLEILYLGQ
NCYFRNPCNVSFFIEKDAFQSLRNLTVLSLKADNLTTVPTTLPSSLTELYLYNNIIQSVK
KDDFQNLHQLQILDLSGNCPRCFNVPFPCVPCPNNSYLKIHPHAFDSLTELRFLRLHSNS
LRNIPERWFKNTNKLEELDLSQNFLAKEIGDAKFLYSLGSLIKLDLSFNYEPQLYLAYLN
LSKAFASLKNLKILRIKGYVFKELKMNNLLPLQNLPQLEVLDLGTNFIKIADLGVFKDLH
SLKNIDLSVNKISPSEESSQXXXXGFCSMARTSTEFHVSQVFDSMHYFRYDEFARRCMFK
SKEKPSLSLINNDCESYGKTLDLSRNNIFFIKSSDFQDLSFLSCLNLSGNSISQALNGSE
FQPLVKLKYLDFSNNRLDLLHSTAFQELQELEVLDISGNSHYFQSEGITHMLNFTKNLPM
LKKLMMNGNDISTSTSTEMESESLRILEFRGNHLDILWRDGDNRYLQLFKNLIKLEELDI
SENFLSFLPAEVFEGMPPNLKTLFLSRNNFKHFSWDKLICLKNLETLDLSYNHLTSVPKV
LSNCSKSLKKLILSNNKIHNLTKNFLQDAFQLRYLDLSSNNLHVIQKSSFPDNVLNRLDM
LLLHGNHFLCNCDAVWLVWWINQTEVTIPYLATEVTCAGPGAHKGQSLVSLNLYTCELDL
TNMILYSTSVFIILCLMVLPVTNHLYFWDMWYSYHFCKAKLKGYQRLVSPEFCYDAFIIY
DTNDTKVGEWVIKELMVNIETQGEKQFNLCLEERDWLPGKPVLENLSQSIQLSKKTIFVM
TNDYIKSGNFKTAFYLSHQRLIDEKLDVIILIFLEKALQRSKYLQLRKRLCKSSVLEWPT
NPQAHPYFWQCLKNAIGTDNDTVYSKVFKETL
Download sequence
Identical sequences ENSMEUP00000013829 ENSMEUP00000013829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]