SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013871 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013871
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.62e-78
Family BAR domain 0.00000000162
Further Details:      
 
Domain Number 2 Region: 283-347
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-23
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013871   Gene: ENSMEUG00000015197   Transcript: ENSMEUT00000015238
Sequence length 352
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2266:18624:93302:1 gene:ENSMEUG00000015197 transcript:ENSMEUT00000015238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFREMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDECNFGPALGDVGEA
MRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQASQILQQVTVRL
EERIREASSQPRREYQPKPRMSLEFSSGDNTQHNGGLSHTSTPKPAGVPMDQPCCRALYD
FEPENEGELGFKEGDVITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Download sequence
Identical sequences ENSMEUP00000013871 ENSMEUP00000013871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]