SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014680 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014680
Domain Number 1 Region: 167-231
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.73e-21
Family PHD domain 0.0015
Further Details:      
 
Domain Number 2 Region: 493-624
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.0000000000746
Family Hect, E3 ligase catalytic domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014680
Domain Number - Region: 373-428
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.00012
Family Hect, E3 ligase catalytic domain 0.018
Further Details:      
 
Domain Number - Region: 28-61
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00523
Family PHD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014680   Gene: ENSMEUG00000016057   Transcript: ENSMEUT00000016108
Sequence length 638
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1387:99:42456:1 gene:ENSMEUG00000016057 transcript:ENSMEUT00000016108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMSSGIWQRGEEKEGVYGFLIEDIKKEVNRASKLKCCICKKSGASIGCVASKCKRSYHFP
CGVQKQCIFQFTGNFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDASWELEENAYQE
LLQHYQRCDVRRCRCKEGREYNEPDSKWEIKRCQYCGSSGTHLACSSIRRDFKKPKKRSL
PSSENIGIANCLLEEPSPKFSRQSPRTQNKDLLREVSMLKRDVSNILRELYQVKQKTQKL
FINKENIWNSAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXLKENLYFEAGRMIAISLVHGGPPPFLFSKTLFNCLVSGPENVEP
ALEDVEDSNMMQIITKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFQQGLRTLGVLETMQKYPEAFYSILCHKPERLTTKIFSDLFTMHKL
SEAQDTRAMGFWMNYLQNVENGESIVTLEDILVFATGCHSIPPVGFQPTPSIEFIHVDYP
VGTKYYNKLTLPVTNTYKEFQENMDAIRNAIELEREKN
Download sequence
Identical sequences ENSMEUP00000014680 ENSMEUP00000014680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]