SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014910 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014910
Domain Number 1 Region: 1038-1235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.63e-44
Family BAR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 913-974
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-18
Family DBL homology domain (DH-domain) 0.00089
Further Details:      
 
Domain Number 3 Region: 763-850
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-16
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 4 Region: 1303-1380
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.00000925
Further Details:      
 
Domain Number 5 Region: 254-310
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000105
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 6 Region: 3-45
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000302
Family SH3-domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014910
Domain Number - Region: 1543-1574
Classification Level Classification E-value
Superfamily SH3-domain 0.0016
Family SH3-domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014910   Gene: ENSMEUG00000016294   Transcript: ENSMEUT00000016350
Sequence length 1576
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_2278:5:66176:-1 gene:ENSMEUG00000016294 transcript:ENSMEUT00000016350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGSVVRAIFDFCPSVSEELPLFVGDVIEVLEVVDEFWLLGKKEDVTXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEED
ENELGAYGALYKFALEPKELDFEVGDRIQILRTLEDGWLEGKLRGKTGIFPYRFVKLFPS
TTMGEAIDIPQESDQNKSPITPLSNLETSFVAHDERNKLHECDVEESTCTVSETSSLSLS
HLTFDCEEDKILYERESVGELPRSPERGCEGRLNKGFLNTDSTKPVNGIFSQTPILPQSS
KQKSLDFHTAAESHQSSEGCSNTLPSEAKDRDSPSVSIRETGSLPRTLGGLVSPLQSSSA
ASDSGLLKSNQLSPKLKDLATKNQQYKPREPSSSFSSISKDMEIQAGLQAKGTVTTAPVL
PQGEGSTDLDSKLTEQLAQFEKSLAVPKAELSKKISRHFSITDFSSEKDIVRGSPTLTTQ
QEPPGRRKVLRPPPPRPCAPASTPHLLVNQNLKPESPSFSMRPSRPAPLPPLAPQRMNLT
SVKSHPPSQLHCDTLEKENSSYLDKTLDSDSQCSFLLVRIQEMEQDLEEFSRTREELNLL
LEEKQDEELTAGTLENLEFCDYHIERLNMELQHLREMTLLSSQSASLQSPSVSVASEDPE
QRMLEKRAKVVEELLQTERDYVRDLEMCIEQIMVPLQQAQVQNMDFEALFGNIQMVVTVS
KQLLAALETTDTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXSLYSEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLANAVLAVK
EINVNINEYKRRKDLGKIGIIPKKEPVNILESICLTCSLVLKYRKGDEDSLMEKISKLNI
HSIIKKSNRVSSHLKHLTGFAPQIRDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRES
ACMKVLAAISMWDVCMEKGNGDLEKFEKVHRYISDQLFTDFKERTERLVISPLNQLLSMF
TGPHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPKFRHY
AQGLFSNCIHGYAEAHCDFVHRALQELQPLLTLLKVADREGNLIAVFHEEHSRVLQQLQV
FTFFPESLPVTKKPFERKTMERQSSRKPLQGLPSYMLQSDELRTTLLGKYPPEKLFQAER
NFNAAQDLDVSLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNSRRSHSD
ASVGSHSSTESEHSNSSPKFPRQSSNNALSINPGNVVADASGPLQQPTQSSALWQESGQE
NVHTSSNSVVPEEAPSRCLLDKDSPSQTRSWNPVDMVDLTRDVDQRTPAVRGYRHTSHPV
TVSQVVPRRNGQPRQGGDLLKGCSKMPPSVEDPNEELESVEAAGNQVYFAVYTFKARSPN
ELSVLANQKLRILEFK
Download sequence
Identical sequences ENSMEUP00000014910 ENSMEUP00000014910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]