SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014999 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014999
Domain Number 1 Region: 480-769
Classification Level Classification E-value
Superfamily L domain-like 2.72e-38
Family Ngr ectodomain-like 0.036
Further Details:      
 
Domain Number 2 Region: 858-1010
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.19e-34
Family Toll/Interleukin receptor TIR domain 0.00011
Further Details:      
 
Domain Number 3 Region: 40-233
Classification Level Classification E-value
Superfamily L domain-like 6.8e-31
Family Ngr ectodomain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014999   Gene: ENSMEUG00000016399   Transcript: ENSMEUT00000016445
Sequence length 1027
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_1801:33806:37656:1 gene:ENSMEUG00000016399 transcript:ENSMEUT00000016445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMILQSLSFTCLCFLVTGNPELSQKVNSRGYPCSIKKNSSVIADCRACRLRDVPKVLEQ
NVTEIDLSFNFIMNITSESFVGLINLTKINLNSNVDSQVENSNVDQNGMKITDGAFFNLT
NLKELQLEDNQLQKMPSHLPPSLTTLSLVLNNIDNITKDSTSGLTQLKTLYLGWNCFYGN
ECKKKVFIDDGAFESLTNLVVLSLSFNNLSNVPTKLPPSLKELYLSNNNIKKIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHRNFYHHTRPLMKRECTSYGK
ALDFSLNSIFFVKPNLFEGLHDVVCLNLSYNGNAQVLNGSEFSSINHIKYLDLSYNRLDF
DDDGAFQELQELEVLDLSHNEHYFQIAGVTHKLGFIQNLTQLKVLNLSHNDIFTLTENQL
ISKSLKELVFKGNRLDILWKKEDKSYIEIFKKLYNLTRLDLSLNRLSMIPTEAFLNLPFS
LEELRLNHNHLYVFNWTSLQYFHSLKLLDLNLIFLSFDISNFSVQTLLLRKNIIAHLPDD
LLSNAKGLYQLDLSYNHIKMIKKSTFQMKDNSSILNIRGNPLDCTCEIGDFRKWMDENLN
VTIPRLVDVTCSTPGDQTGKSIMELELTTCVSDLVAAIFFSFSFIITVTIMVMATFHHLF
YWDIWYIYHLCSAKIKGYKSISTSQTFYDAFIAYDTKDTCVTDWVINELRFQLEENEEKK
VLLCLEERDWDPGIAIIDNLMQSIKQSKKTIFVLTKKYVKNWNFKTAFYLALQRLMDDNM
DVIIFILLEPVLQHSQYLRLRRRICKSSVLKWPDNPKAEDLFWQSLKNVVLTDNDSRYNN
LYVKFTK
Download sequence
Identical sequences ENSMEUP00000014999 ENSMEUP00000014999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]