SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015000 from Macropus eugenii 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015000
Domain Number 1 Region: 203-365
Classification Level Classification E-value
Superfamily MIR domain 3.53e-39
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 3881-3959
Classification Level Classification E-value
Superfamily EF-hand 0.000000013
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 3 Region: 641-788
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000206
Family SPRY domain 0.045
Further Details:      
 
Domain Number 4 Region: 415-531
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000017
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 5 Region: 1061-1114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000017
Family SPRY domain 0.052
Further Details:      
 
Domain Number 6 Region: 2037-2101
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000497
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Domain Number 7 Region: 87-168
Classification Level Classification E-value
Superfamily MIR domain 0.0000458
Family MIR domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000015000
Domain Number - Region: 1322-1431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00131
Family SPRY domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015000   Gene: ENSMEUG00000016320   Transcript: ENSMEUT00000016446
Sequence length 4795
Comment pep:known_by_projection genescaffold:Meug_1.0:GeneScaffold_9738:8616:383240:1 gene:ENSMEUG00000016320 transcript:ENSMEUT00000016446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEVVLQCVANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVPPDLSICNFVLEQSLSVR
ALQEMLANTGENASEGVAQGGGHRTLLYGHAILLRHSFSRMYLTCLTTSRSQTDKLAFDV
GLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSISNGNIQVDASF
MQTLWNVHPTCSGSSIEEGYLLGGHVVRFFHGHDECLTTLSTDQNDSQHRRIFYETGGAG
SRARSLWRVEPLRISWSGSNIRWGQAFRLRHITTGHYLALTEDQGLILQDREKSDTKSTA
FCFASKEIKEKLDSSHKRDIEGMGIPEIKYGDSICFVQHVASGLWMTYKAQDAKTSRLGP
LKRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNNRSAAPIILPIEE
VLQTLQDLITYFQPPEEEMQHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNVYNSV
AHLTGFAREESGTAWKEILNLLYQLLAALIRGNRNNCAQFSNNLDWLISKLDRLESSSGI
LEVLHCILTESPEALNLISEGHIKSIISLLDKHGRNHKVLDVLCSLCLCNGVAVRANQNL
ICDNLLPRRDLLLQTRLINDVTSIRPNIFLGVAEGSAQYRKWYFELIIDQVDPFLTAEPT
HLRVGWASSPGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSGRVPRAVASVNQHLLKS
DDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVVSFSAGIKVRFLLGGRHGEF
KFLPPSGYAPCYEALLPKEKMILEPVKEYKRDSEGIRDLLGTTRFLSQASFIPCPIDTSQ
VVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRLHPCLVEFSKLPETEKNY
NLQMSTETLKTLLALGCHIIHVNPAAEEDLKKVKLPKNYMMSNGYKPAPLDLSDVKLLPP
QEILVDKLAENAHNVWAKDRIKQGWTYGIQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDQTMEKVSVDKIRFFRVEQSYAVKSGKWYFEFEVVTGGD
MRVGWARPGCRPDVELGADDQAFVFEGSKGQRWXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTRIDGMMDAPPCLKVTHKTFGT
QNSSAEMVYCRLSMPVECNSSFHHSTGLESDVFQKRKQIQEIVAQTTTXXXXXXXXFAGQ
DPSYTWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVHESVKRSNCYMVWGGDIIAN
SQRSSQSNVDLEIGCLIDLATGMISFSANGKELDTCYQVEPNTKVFPAVFQPTSTSFQFL
GKLKSAMPLSAAIFKSEERNLVPQCPPRLDVQTIQPVLWSRMPDSFLKIEMERVSERHGW
MVQCLEPLQMMALHIPEENRCVDILELCEQEDLMRFHYHTLKLYSAVCALGNNRVAYALC
SHVELSQLFYTIDNQYLPGLLRCGFYDLLISIHLAHAKERKLMMKNEFIIPITSTTRKIR
LYPDESKRHGLPGVGLSTCLKPGFNFSTPCFIVTSEDRQKLSPEIPLEILKTKALSMLTE
AVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDNDDVRQILLLIDPTVXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMCELLSYFCDCELRH
RVEAIVAFGDIYVSKLQANQKSRYSELMQALNMSAALTARKTREFRSPPQEQLNMLLNFQ
LGENCPCPEEIREELYDFHDDLLIHCGIPLEEEKEEEEDTSWTGKLMALVHKIKGPPKPE
KEQPMEEEEPCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIMNNKVFYQHPNLMR
VLGMHETVMEVMVNVLGGEKSQIAFPKMVASCCRFLCYFCRISRQNQKAMFEHLSYLLEN
SSVGLASPAMRGSTPLDVAASSVMDNNELALGLEEPDLEKVVTYLAGCGLQSCPMLLAKG
YPDIGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKLLIRRPECFGPALRGEGGNGLL
AAMQGAIKISENPALDLPSQGYKKEINSEEDDSEEIVHMGNSIMSFYSALIDLLGRCAPE
MHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSLSTTEAALALNRYLCSAVL
PLLTRHAPLFAGTEHYGSLIDSTLQTIYRLSKGRSLTKAQRDTIEECLLAICXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLLTNHYEQCWKYYCLPSGWGGYGLAVEEELHLTEKLF
WGIFDSLSHKKYDTDLFRMALPCLSAIAGALPPDYLDTRITATLEKQTSVDAEGNFDPKP
INTVNYSLPEKLEYVVTKYAEHSHDKWACDKSQNGWKYGISLDENVKTHPLIRPFKTLTE
KEKEIYRWPARESLKTMLAVGWTVDRTRESEAILQQRENEKLRSISQASQGNSYNPAPLD
LSNVVLSREVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVLLPLVDQYFTNHCLYFLSSPLKPLSSSGYASNKEKEMVAX
XXXXXXXXXXXXXXXXXXDSTTMVSCLHILAQTLDTRTVMKSGSELVKAGLRAFFENAAE
DLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPILTSIYEHVAQHQFGVDLLLSDV
QISCYHILCSLYSLGTGKNIYVERQRPALGECLAALAAAMPVAFLEPSLNCYNSLSVFNT
KTPRERSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAQPI
ISKARADLLKSHFIPTLEKLKKKAVKIVLEEEQLKADSKGDTQEAELLILDEFAVLCRDL
YAFYPMLIRYVDNNRSNWLKNPDADSDELFRMVAEVFILWCKSHNFKREEQNFVIQNEIN
NLAFLTGDSKSKMSKVKSIVSGGQDQERKKAKRRGDLYSIQTSLIVAALKKMLPIGLNMC
TPGDQELISLAKIRYSYRDTDEEVRDHLRNNLHLQEKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVEQPLRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPHR
SINLFLHGYQRFWIETEEYSFEEKLVQDLAKPPKVEEEDEDEGEKQPDPLHQIILHFSRN
ALTEKSHLENDPLYTAYSGMMAKSCQSGEEEEEEEKEKTFEEKEMEKQKTLYQQARLHDR
GAAEMVLQMISASKGEMGPMVVETLKLGIAILNGGNPGVQQKMLDYLNERKDAGFFQSLS
GLMQSCSVLDLNAFERQNKAEGLGMVTEEGTXXXXXXXEKVLQNHEFTCDLFRFLQLLCE
GHNSDFQNFLRTQMGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDVIDESGQRNFSK
ALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIKLL
KELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTN
SDAFKEYDPDGKGIISKKEFQKAMEGQKQYPQSEIEFLLSCAEADENEMFNYIDFVDRFH
EPAKDIGFNVAVLLTNLSEHMPNDSRLQCLLDPAESVLNYFEPYLGRIEIMGGAKKIERV
YFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEKMELFVNFCEDTIFEMQLASQISE
SDSAERPEEEDDEEEFSCVAEAEEDEEENRSLESASAFATACVSVKKNVSSFLKMASLRN
LKKQYRKVKKMTVKELVKVFFSFFWMFFVGLFQLFFTIVCGIFQILWNTVFGGGLVEGAK
NIRVTKLLGDMPDPTQFGIHDDVIEAERAEAAEQSITADLVHFVKGEKGEADIMSDLFGL
HPKKEGGTKHGPDPGLGDLSEIIGNDGPPTLESTVQKKRKAQAAEMKTESEREGKVESEK
AXXEDEKQDKVKEEEQEENLGGGKTNKKRRHGQKEERPEAFMANFFKGLEIYQTRMLHYL
ARNFYNLRFLALFVAFAINFILXXXXVTEEPFEDDAEDSNLWTPFNEEEEEEEGMVFFVL
QESTGYMAPTLRALAIIHTIISFVCVVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQP
SEDDIKGQWDRLVINTPSFPSNYWDKFVKRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXRSSIDMKYHIWKLGVVFTDNSFLYLAWYTTMSILGHYXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPD
MKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQ
GLIIDAFGELRDQQEQVREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANY
Download sequence
Identical sequences ENSMEUP00000015000 ENSMEUP00000015000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]