SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000010 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000010
Domain Number 1 Region: 6-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.21e-61
Family BAR domain 0.002
Further Details:      
 
Domain Number 2 Region: 287-447
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000010   Gene: ENSMEUG00000000010   Transcript: ENSMEUT00000000010
Sequence length 806
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9418:6149:126408:1 gene:ENSMEUG00000000010 transcript:ENSMEUT00000000010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMRQLANQTVGRAEKTEVLNEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGV
EADKRSKKLPLTALAQCLMEGSAILGDETLLGKMLKLCGETEDKLAQELIHFELQVERDV
IEPLFVLAEVEIPNIQKQRKHLAKLVLDMDSSRTRWQQTSKSSGLSSNLQPSGAKADALR
EEMEEAANRVEICRDQLSADMYSFVAKEIDYANYFQMLIEVQAEYHRKSLTLLQNVLPQI
KAQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFRVAPSASKLK
KLKAALDCCVLDVQEYSADPHAIAGALKSYLRELPEPLMTFELYEEWIQASNIQDQDKML
QALWNTCEKFPKANHNNIRYLIKFLAKLSEFQDTNKMTPSNMAIVLGPNLLWPQADGNIT
EMMTTVSLQIVGIIEPIIQHADWFFPGEIEFNVTGNYGSPIHVNHNANYSSVPSPDMDPP
DQRQPEPVRRPLSVATDNMMLEFYKKDGVSFPTSMGVRVMDTSWVARRGSSVTRKSSCTP
PTVQPPAPPSDLTVPPQSPVPEELLDISATSSHSPSSFGSQSMAEQTSTLQSKELSPGSG
QKESQSSSHGVLCVSTQPMTTLSQPPTDQSPHTLRKVSRKLAPIPPKVTFSQLGGMTDQS
AGQPSPVSLSPTPPSTPSPYGLNYPQGYLLVSGQLPPATTLSLSTPVVTSTLTKSRPTPK
PRQRPTLPPPQPPTVNTSGSGSQSVDHLVIDGMSSGESMSTDLVHFDIPSIHVELGSSLH
PGLLEHMRQAGTEKRDSEEESESTAL
Download sequence
Identical sequences ENSMEUP00000000010 ENSMEUP00000000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]