SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000022 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000022
Domain Number 1 Region: 4-151
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.35e-58
Family G proteins 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000022   Gene: ENSMEUG00000000023   Transcript: ENSMEUT00000000023
Sequence length 151
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1257:110428:116101:1 gene:ENSMEUG00000000023 transcript:ENSMEUT00000000023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLEEINRYASENVNKLLVG
NKSDLTTKKVVDNPTAKEFADSLGIPFLETS
Download sequence
Identical sequences ENSMEUP00000000022 ENSMEUP00000000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]