SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000049 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000049
Domain Number 1 Region: 263-348
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.71e-25
Family Arfaptin, Rac-binding fragment 0.0000327
Further Details:      
 
Domain Number 2 Region: 152-207
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000628
Family Arfaptin, Rac-binding fragment 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000049   Gene: ENSMEUG00000000057   Transcript: ENSMEUT00000000053
Sequence length 371
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4734:3987:52771:1 gene:ENSMEUG00000000057 transcript:ENSMEUT00000000053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQESLKNSAAEIPVTSNGEVEDAHEHGFSRDLKRSLPAGLGLSETQITSHGFDSTKEGV
IESGPFQGSPAPPMSSVIPPSNAAASRLAEPGRDLIGPAGSQRMQQKSGPVILADETKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRENEKYENILKLAQT
LSSQLFQMIHTQRQLGDAFALSLKSLELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKE
KYDKIRNDVSIKLKFLEENKVKVLHNQLVLFHNAITAYFAGNQKQLEQTLKQFHIKLKTP
GVDAPSWLEEQ
Download sequence
Identical sequences ENSMEUP00000000049 ENSMEUP00000000049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]