SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000068 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000068
Domain Number 1 Region: 135-200
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 1.44e-27
Family AN1-like Zinc finger 0.0000153
Further Details:      
 
Domain Number 2 Region: 16-57
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000185
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000068   Gene: ENSMEUG00000000074   Transcript: ENSMEUT00000000074
Sequence length 201
Comment pep:novel scaffold:Meug_1.0:Scaffold7387:21913:29006:-1 gene:ENSMEUG00000000074 transcript:ENSMEUT00000000074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGEMAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGSASGSN
SPTSDSASVQRAEASLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKT
EATEPVVTQPSPSVSQPSTSRSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGL
HRYSDKHNCPYDYKAEAAAKI
Download sequence
Identical sequences ENSMEUP00000000068 ENSMEUP00000000068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]