SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000601 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000601
Domain Number 1 Region: 386-637
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-52
Family Nuclear receptor ligand-binding domain 0.0000000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000601   Gene: ENSMEUG00000000651   Transcript: ENSMEUT00000000653
Sequence length 639
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3284:19149:39476:1 gene:ENSMEUG00000000651 transcript:ENSMEUT00000000653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNKSVRCGNMDMPCVQAQYSPSPPGSSYAAQTYAYGSEYTSEIMNPDYTKLNMDLSSTEI
TATATTSLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXRGRLPSPKSPLQQEPSQPSPSPVNVMNVRALTDSTPR
DLDYSRYCSGDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIES
AFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIP
ALACLSALSMITERHGLKEPKKVEELCKKITSSLKDHLAFGCQTKGQPLEPAEPKVLGAL
ADLRSLCTLGLQRIFYLKLEDLVPPPSIIDKLFLDTLPF
Download sequence
Identical sequences ENSMEUP00000000601 ENSMEUP00000000601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]