SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000605 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000605
Domain Number 1 Region: 3-154
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.05e-49
Family IMD domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000000605
Domain Number - Region: 207-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0272
Family IMD domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000605   Gene: ENSMEUG00000000657   Transcript: ENSMEUT00000000657
Sequence length 753
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7920:54522:199158:-1 gene:ENSMEUG00000000657 transcript:ENSMEUT00000000657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVIEKECSALGGLFQTIISDMKGSYPVWEDFINKAGKLQSQLRTTVVAAAAFLDAFQK
VADMATNTRGGTREIGSALTRMCMRHRSIETKLRQFSSALIDCLINPLQEQMEEWKKVAN
QLDKDHAKEYKKARQEIKKKSSDTLKLQKKAKKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEEEISMLGEITHLQTISEDLKSLTMDPHKLPSSS
EQVILDLKGSDYSWSYQTPPSSPSTTMSRKSSVCSSLNSVNSSDSRSSGSHSHSPSSHYR
YRSSNLPQQAPMRLSSVSSHDSGFISQDAFQSKSPSPMPPETPNQLSNGFYHYSLPSEPH
VASVSAGLYPHCLPASRLCPRATSALLPDYVHYYTIGPGMLPSSKIPSWKDWAKPGPYDQ
PVVNTLQRRKEKREPDSNGGPSGIPSAPAEEAQRPRSMTVSAATRPGEEMEACEELALAL
ARGLQLDPQRSSRDSLQCSSGYSTQTTTPCCSEDTIPSQVSDYDYFSVSGDQETEQQEFD
KSSTIPRNSDISQSYRRMFQAKRPASTAGLPTTLGPVIVTPGVATIRRTPSTKPSVRRGT
IGAGPIPIKTPVIPVKTPTVPDLPGMLPSPQGGPEGHGEHSPESPSVGDTTQGGTNMPSS
MWSGQASINPPLPGPKPSVPEEQRQSAPETEDEETEGDHSSPTSSPGQTPECSNPGDLSP
GDTLQGEDMLNAIRRGVKLKKTLTNDRSAPRLS
Download sequence
Identical sequences ENSMEUP00000000605 ENSMEUP00000000605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]