SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000759 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000759
Domain Number 1 Region: 8-40
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000379
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 2 Region: 142-200
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000022
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000000759
Domain Number - Region: 176-275
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0009
Family Arfaptin, Rac-binding fragment 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000759   Gene: ENSMEUG00000000821   Transcript: ENSMEUT00000000821
Sequence length 548
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7953:11196:23971:1 gene:ENSMEUG00000000821 transcript:ENSMEUT00000000821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENWNNCFEEELICPICLHVFVEPVQLPCTHNFCRGCIGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSCPQHNAYRLYCEAEQVAVCQYCCYYSGAHQGHAVCD
VEIRRNEIRKMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVSQLKDEVRLQYEKLHQ
LLDEDLRQSMEILDKAQAKFCNENAAQALHLTERMQEAKKLLSSVQLVFDKTEDISFMKN
TKSVKILMDRTQSCTGGSLSPPKIGHLNSKLFLNEISKKEKQLRKLLEGPFSTPVPFLQT
VPLYPCGVNSSSGAEKRKHQTAFPEASFLESPAGPVGSQCGPAGAGEGQSSQLGPCSSTQ
HLVALPGGAQPVHSSSVFTPSHYPNGTAPQQPVLPQYGGRKILVCSVDNCYCSSVSNHGS
HQPYPRSGHFPWTVPSQEYSHPLPPAPSVPQSLPGLAVRDWIDASQQPGHQDFYRVYGQP
STKHYVTS
Download sequence
Identical sequences ENSMEUP00000000759 ENSMEUP00000000759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]