SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000789 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMEUP00000000789
Domain Number - Region: 109-150
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0476
Family FCH domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000789   Gene: ENSMEUG00000000857   Transcript: ENSMEUT00000000857
Sequence length 195
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7285:3071:42432:1 gene:ENSMEUG00000000857 transcript:ENSMEUT00000000857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNDQSAEAESRPHDLSASVTPPTKQKAKMDDIVVVAQGTQASRSISSDPDVIKLQEIPT
FQPLLKGLLSGQTSPTNTKLEKLDSQQVLQLCLRYQDHLHQCAEAVSFDQNALVKRIKEM
DLTVETLFGFMQERQKRYSKYAEQIQKVNEISSILRRIQMGIDQTVPLMERLNSLLPENE
RLEPFSMKPERELKS
Download sequence
Identical sequences ENSMEUP00000000789 ENSMEUP00000000789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]