SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000000922 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000000922
Domain Number 1 Region: 1179-1444
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.68e-55
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000807
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000000922
Domain Number - Region: 512-695
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0408
Family BAR domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000000922   Gene: ENSMEUG00000000986   Transcript: ENSMEUT00000001001
Sequence length 1623
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_966:1558:43433:1 gene:ENSMEUG00000000986 transcript:ENSMEUT00000001001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVPRMPMIWLDLKEAGDFNFQPAVRKXXXXXXXXXXXXXXXXXXXXXXXXXNAIRVPR
DFEGCSILRKYLGQLHYLQSRIPMGLENEAAVPITWTEIFSGKSVTHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFTYLQEHFPHSYSVDMSHQILNLNINL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVVYYKEACRALENPETASLLGKVQKDWKKL
VQMKTCYFAAVAHLHMGKQAEEQQKFGERVVYFQSALDKLNEAIKLAKGQPETVQDALRF
TMDVIGGKFNSAKKDNDFIYHEAVPVLDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMMAKIDAKNEVLDQFMDSLQLDPETVDNLDVYNHIPPV
LMEKCAALSVRPDTVKNLVQSMQVLSGVYTDVEASLKEIKGLLEEDELLEQKVQEVSGQP
GAVPAGGLAEVSREWAKYMEVHEKASFTNSELHRAMNLHISNLRLLSGPLDQVRAALPTP
ALTPDDKAVLQNLKRILAKVQEMRDQRLSLEHQLRELIQKDDITTSLVTTDRSEMKKLFE
QQLKKYDQLRVYLDQNLTAQENVLKALTEANVQYAAVRRVLTELEHKWNSTLQTLVASYE
AYEDLMKKSQEGKDFYADLESKVTALLERAKAACQAREAAFQQLLSRELKKKPPPRPTAP
KPLLPRKEEGEAIEPGDLPEELRSLPPDMLAPRLPDAFLGAGAVIPFPPGHFTVPGSHYF
PGPFPPVTYSGPPPLLQPSAPQPTGLPLAGMSPGPRLYPAPTYTPDPSLIPGSSPQRRVV
SSHYALGPAPGGLPTAPPPRFISPELTPGIRPATTTVDSIQAPISSYTAPRPGPSPSPAP
SRPCYSASQQGLPAVPYPYPVGVCQPFLPPPNFLPPASRGELQPRPQPYASQVPFVPQPR
PPPIQHPQVFPPQTGSLLPLPPFPFVTQPAVLGQLPPPLGTHLYPLPSQDPLPPHSGALP
FPTPAPPQPPHTPLAYCPAPASRPQVPQAPSLPSRGPPPSSQPSPSSHPVPSPAPSPGPG
PTTPHPSQAEPPPFQRCNSSTADLLSSSPESQHGGSQPPGGGHPLLQPTKADATEGQRPQ
ALRLIECDPYEQPQRLQQLQEELEAFRGLLSGGAGALDGVWRELQEAQERDARGRSIAIA
RCYSLKNRHQDIMPYDSNRVVLRSGKDDYINASRVEGLSSYCPPLIATQAPLPGTAADFW
LMVHEQKVSVIVMLVSEAEMEKQKVAKYFPTERGQPLVQGPLSLVLSSVRTTDTHVERVL
SLQFRDQSLKRSLVHLHFPTWPELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS
GVGRTGAFALLYAAVQEVEAGNGIPALTQLVRQMRQQRKHMLQEKLHLRFCHEAVLRHVE
QVLQRHGVAPPSACRPLANSSVAQKAYLPQDPQDLVLGADMPISSIQATIAKLSIRPQVG
GQEPPPVALPSPAEPLSPTTPNLQELTRPPSPSPPSSPKPEVPEPKEESQVPAIPSPGPP
TSSLELLASLTPEAFSLDSSLRGKQRMNKQSFLQAHNGQGLRGAGPSDDPLSLLDPLWTL
NKT
Download sequence
Identical sequences ENSMEUP00000000922 ENSMEUP00000000922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]