SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001321 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001321
Domain Number 1 Region: 1080-1217,1322-1590
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.83e-110
Family Myotubularin-like phosphatases 0.00000589
Further Details:      
 
Domain Number 2 Region: 1663-1840
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-22
Family Pleckstrin-homology domain (PH domain) 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000001321
Domain Number - Region: 850-989
Classification Level Classification E-value
Superfamily PH domain-like 0.0197
Family GRAM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001321   Gene: ENSMEUG00000001426   Transcript: ENSMEUT00000001444
Sequence length 1842
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1562:68192:97188:-1 gene:ENSMEUG00000001426 transcript:ENSMEUT00000001444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGEGHGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPERNPPTFFIAVLTDINSERHY
CACLTFWEPVEPSQHAMERKRRRLERGSPSALVPPTQLFAPKTLVLVSRLDHAEVFRNSL
GLIYTIHVEGLSVSLENVIGNLLTCTIPITGGSQRTISLGAGDRQVIQTPLTDSLPISCC
SVALLFRQLGITNVLALFCAALTEHKILFLSRSYQRLTDACRGLLALLFPLRYSFTYVPI
LPAQLLEVLSTPTPFIIGVXXXXXXXXXXXLDVIIADLDGGTVTVPECVHIPPLPEPLHS
QTHSALCMVLDPELELADLAFPPPATSPSSLKMQDKELRAVFLRLFAQLLQGYRWCLHIV
RIHPEPVIRFHKAAFLGQRGLVEDDFLLKVLEGMAFAGFVSERGVPYRTTDLFDELVANE
VKRMRADENQPHRVLRHVKELAEQLYKNENPYPAVTMHKVQRPGEGSHLRRVPPRPFPRL
DESTVQWIIDQATAKLQGAPPAVRAEKKATVPSGPPMAAIVERNGAIHANSARRLEVVRN
CISYVFEGKMLEAKKLLPAVLRALKGRAARRCLTRELHLHVQQNRAVLDHQQFDFVVRMM
NCCLQDCTAMDEHGIAAALLPLVTAFCRKLSPGVTQFAYSCVQEHVVWSTPQFWEAMFYG
DVQTHIRALYLEPAEEEEEEEEERSALDVASEQRRLWPTLGRDKQQELVQKEESTVFSQA
IHYANRMSYLLLPLDSSKSRLLRERAGLGDLESVSNSLVTNSMAGSMAESYDTESGFEDA
ETSDVAGAVVRFINRFVDKVCTESGVTSEHLKGLHVMVPDIVQMHIETLEAVHRESKRLP
PIQKPKLLRPSLLPGEECVLEGLRVYLLPDGREEGSGGSIGGPALLPAEGAVFLTTYRVI
FTGMPTDPLVGEQVVVRSFPVASLTXXXXXXXXXXXXXXXXXXXXXXXXXXXLLKMAFDE
EVGSESAEVFRKHLHKLRYPPDVKGTFAFTAGSIHTAGRQPRTAKEKSPSLRTLSRNLVK
NAKKTIGRQYVTRKKYNPPSWEQRGQPVAPEDQEDEISVSEEPEPSTLTPASALKPSDRL
TMNSLVERACCRDYQRLGLGTLSSSLSRAKSEPFRVTPVNRMYAICRSYPGLLIVPQSIQ
DNTLQRISRCYRQNRFPVVCWRSSRSKAVLLRSGGLHGKGVVGLFKAQNAPSPGQSQADS
SSLEQEKYLQAVVSSMPRHADAASGRNTLSGFSSTHMASHXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYII
GDKAQLKGVRPDPLQQWELVPIEVFEVRQVKASFKKLLKACVPGCPAGEQSPTSYLRSLE
ESEWLSQIHKLLQVSVLVVELLDSGSSVLVSLEDGWDITTQVVSLVQLLSDPYYRTLEGF
RLLVEKEWLSFGHRFTHRGAHTLAGQSSGFAPIFLQFLDCVHQVHLQFPMEFEFSQFYLK
FLSYHHVSHRFRTFLLDSDYERIELGLLYEEKGERKSQQACKSVWEYVERLSKKTPVFHN
YMYAPEDTEVLRPYSNVSNLKVWDFYTRETLAEGPPYDWELAQGPPEPLEEERPDGGAPQ
SRRRVIWPCYDSRLRAQPDAISRLLEELQRLEAELGRPSERWKDTWDRVKAAQRSEARHD
GRSTPSSLLMSSVSHHRRSLGVYLQEGPMGSTLSLSLDSDQSSSSTPSSGRQAARRSTST
LYSQFQTAESENRSYEGTLYKKGAFMKPWKARWFVLDKTKHQLRYYDHRVDTECKGVIDL
AEVESVTPGTPTMGAPKTVDEKAFFDVKTTRRVYNFCAQDVH
Download sequence
Identical sequences ENSMEUP00000001321 ENSMEUP00000001321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]