SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001352 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001352
Domain Number 1 Region: 2450-2571,2603-2720
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.5e-26
Family Extended AAA-ATPase domain 0.063
Further Details:      
 
Domain Number 2 Region: 1463-1676
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-23
Family Extended AAA-ATPase domain 0.027
Further Details:      
 
Domain Number 3 Region: 1691-1910
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000644
Family ABC transporter ATPase domain-like 0.077
Further Details:      
 
Domain Number 4 Region: 2108-2199,2231-2392
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000234
Family Extended AAA-ATPase domain 0.088
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000001352
Domain Number - Region: 2935-3005
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0565
Family FCH domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001352   Gene: ENSMEUG00000001411   Transcript: ENSMEUT00000001477
Sequence length 4180
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2893:1923:138908:1 gene:ENSMEUG00000001411 transcript:ENSMEUT00000001477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMYPEIKARGFYSDVLTPGTLAILGDVCTGAIVHKDLLRQADLDQFTPNVMTFQIPEDFE
DHLSQERIGPTTEILVKSDFPLKAYEPKVQVPFQTLPGHCPRKIEIERRKRQYLKLDINQ
LLAAEGIDSNLLMPRHPDPKNMQTIEQRNDPLFPIYLPLQVFDDEEFDCRTPEEWMAMGL
EPGCEDRKPVPGKALLPTDDFLGHEDPKSRRLTYTWNHVGVLDYDSKKKLYLVHKTDERG
LIRDDLGNPILNGGMTPEGRALLLPCQYWVPRIQLLFCAEDPRVFTKRVVSANSLRKKTE
ALLLYNLYVDCMPTEGLRILSEESLSMIKQRTMSTPRMRKGTXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIAMPEYPFLEQKEAFTFVSLLTR
TEVILALGKVRAECNKVTAMTLFHYTLSKFGRLEEFEQIQSQMFSQVQMFLKDSWVSTLK
VAIRSSLRDMSKGWYNLYETNWEVYQMSKLHKLMELIKYTLQDSIRFLVQDSLVNFTQFI
LDACCNVLNCSEDMVWGPDLINSPYKPRKNPLFIVDLVLDNSGPHYSTPMENFMTSLLNL
FDKGILATHSVPQLEKFVMENIFVSGVPLLESVGLHEPLVEDLRKSLSNAMEKAMIPLSA
YAKEFRKHLDLNNKDIRTFLEVREVVMSHLQEKEILDNSLPSNIIIGPFFINVENTKQNL
SKKCKALATSVLDILAKNLHQEVDSICEEFRFISRKIYEKPNSIEELAELREWMKGIPEV
LTGLEERIVKVMDDYQVMDDFFYNLTTDDFNDKWAASNWPYKIVGQIELIREMHREEEEK
FHKIQLMDQNNFLEKLDGLQLVVAGFSIHTEIARAHEIANEVRRVKKQLKECQQLATLYN
NRERIFGMPITNYDKLYKMIKDFQPYLDLWTTASDWLRCSESWMNDPLTSIDAEQLEKNV
IEAFKTMHKCVKQFRDVPACQEVAVDIRNRIDDFKPYIPLIQGLRNPGMRNRHWEMLSES
INISIKPKANLTFARCLEMNLQDHIETIGKVAEVAGKEYAIEQALDKMEKEWVTVLFNVL
PYKETETFILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEHRINWESKLRLTQEVLEEWL
TCQRSWLYLEPIFSSEDINRQLPVESKRYQTMERLWRKIMKNANENREVINVCADQRLLD
SLRDCNKLLDLVQKGLSEYLETKRASFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFE
NIARLLFQEDLKITHMYSGEGEEVELSFSIYPTGNVEDWLLEVEHSMKASVHDFIERAIQ
AYPETPRPQWVLNWPGQVTIAGCQTFWTKEVSEALEAGDLESRLFPQLSAQLQDLVALVR
GKLSRMQRAVLSALIVIEVHAKDVAAKLIDERVVSVNDFEWISQLRYYWTRNDLYIRAVN
AEFVYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKAL
AIQTVVFNCSDQLDFMAMGKFFKGLASSGAWACFDEFNRIDVEVLSVVAQQITTIQKAQQ
QRVDRFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYTMIAEIS
LYSFGFSDAKVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMDEE
LICLRAIRDVNVPKFLQDDLKLFSGIVSDLFPNIKEEKIDYGILDQAIRQACFRDNLKDV
DGFLTKCIQLYETTVVRHGLMLVGPAGSGKTKCYKVLAAAMTSLKGKPSISGGMYEAVHY
YILNPKSITMGQLYGEFDLLTHEWTDGIFASLIRGGAIASDTDKKWYMFDGPVDAVWIEN
MNTVLDDNKKLCLSSGEIIKLTESMTMMFEVQDLAVASPATVSRCGMVYLEPSILGIMPF
TECWLRKIPSVMMPYQEKFESLFQRFLEESIEFVRASVKEVIASTNSNLTMSLLKIMDCF
FKPFLPKEGVKKFPHEKLIRIPELVEPWFIFSLIWSVGATGDANSRRAFSAWLRTKMVVE
EIGLRFPEEGLVFDYRLDDCGISSLEDFEEEEDENKEVSWVKWMDISAPFTMVPDTSYSN
IIVPTMDTVQMSFLLGMLLTNKKPVLCIGPTGTGKTITISDKLLKNLPLEYITHFLTFSA
RTSANQTQDLIDSKLDKRRKVFGPLGRYFIFFIDDLNMPALETYGXXXXXXXXXXXXXXX
XXXXXXXXXMFKQLVDINFVCAMGPPGGGRNAITPRFSHHFNYLSFIEMDDLSKKRIFST
ILGSWMAGLLGEKSYRDPVPGAPEVEDLNKPLVEATIQVYATITSQLLPTPAKSHYTFNL
RDLSKVFQGMLMAEPSKIQDKVQLLRLWYHESCRVFRDRLVNDEDRIWFDKLMESKMVLW
KTSFSEVCPYQPILYGDFMMPGSDSRVYELITKRRMQHVIEEYMEDYNQVNTTKMKLVLF
MDAIGHICRISRILRQSLGNALLLGVGGSGRNSLTRLASHMAEYECFQIELSKNYGMSEW
REDVKKILLKAGLYKLPVTFLFSDTQIKNESFLEDINNVLNSGDIPNLYSPDEQDQILTS
MRPLIQELGLQPTKANLMAAYTGIVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDW
FNEWPSEALESVASRFLKEIPELDNTNEEGLIQVCVRIHQSVAKKCIEYLAELARHNYVT
PKSYLELLNIFSTLIGQKKQELNTAKHRMKSGLDKLLRTSEDVAKMQEELEVMRPLLEEA
AKDTVVTMEQIKADTAIAEDTRNAVQAEEMKANEKAKKAQAIADDAQKDLDEALPALDAA
LASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGK
GLLQDPGKFLESLFKFDKDNIADSVIKAIQPYIDNDEFQPAAIAKVSKACTSICQWVRAM
HKYHFVAKAVEPKRQALREAQEDLDATQKILDIAKNQLREVEDGISTLQTKYRDCIAKKE
ELEMKCEQCEQRMGRADKVRPVLHLLASVHTRRDPQLISGLADEKVRWQETVTNLDYQIN
NIYGDILMSAGFVAYLGPFTGQYRTSLCELWLEQLSKFEVPHTAEPTLIGTLGNPVKIRS
WQIAGLPNDTLSVENGVIAQYSQRWNHFIDPQGQAKKWIKNLEKDYGLDVFKLSDRDFLR
SLENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDSVIPYHEDFRMYIT
TKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEDAKNQLIVSNAKMRQ
ELKDIEDQILNRLSSSEGNPVDDEELIKVLEASKMKAGEIQAKVRIAEQTEKDIDLTRME
YVPVAVRTQILFFCVSDLSNVDPMYQYSLEWFLNIFLSGISNSERADTLKKRIANINKYL
TFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGRIDLGEWRYLLSGGSIKDVIENPAVDW
LSDRAWRDILALTNLPNFSTLATDFIVHMDDFRRIFDSVEPHRXXXXXXXXXXXDQFQKL
LILRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLFAVFKDSNSTTPLIFVLSPGTDPAA
DLYKFAEEMKFSKKLTAISLGQGQGPLAEAMMQSSMERGKWVFFQNCHLAPSWMPSLERL
IEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYSGLNDDFL
NSCHKQSEFKCLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYE
NIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYHPVVLEPEHIYSESGIYHQINPT
YDINGYLQYIKSLPLNDIPEIFGLHDNANITFAQNETFALLNAIIQLQPKSTSTGGQSRE
EIVEDIAGSILLKIPDPINVHQVMAKYPVLYEESMNTVLVQEVIXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMGKSLSELTSRPEVGCF
IHGLFLEGARWDPDRFFLAESRPKELYTEMAVIWLVPVPNRKPPIRGFYVCPIYKTLTRA
GTLSTTGHSTNYVIAVEIPTDKKQRHWIKRGVALICALDY
Download sequence
Identical sequences ENSMEUP00000001352 ENSMEUP00000001352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]