SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001642 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001642
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily C-type lectin-like 1.05e-23
Family C-type lectin domain 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001642   Gene: ENSMEUG00000001801   Transcript: ENSMEUT00000001802
Sequence length 99
Comment pep:novel scaffold:Meug_1.0:Scaffold54000:10232:11755:-1 gene:ENSMEUG00000001801 transcript:ENSMEUT00000001802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYPSGHLGSLLNEAEASFVATMIMENEIGENPVWIGLHDPNKNHRWRWSSNALYLYQAWG
TGSPTNSNYCVTLTPQSGFQSWKDEPCQKQYLYLCKFEA
Download sequence
Identical sequences ENSMEUP00000001642 ENSMEUP00000001642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]