SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001651 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001651
Domain Number 1 Region: 148-393
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-58
Family Protein kinases, catalytic subunit 0.0000152
Further Details:      
 
Domain Number 2 Region: 817-867
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 884-1003
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000165
Family Pleckstrin-homology domain (PH domain) 0.073
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000001651
Domain Number - Region: 419-545
Classification Level Classification E-value
Superfamily Tropomyosin 0.00275
Family Tropomyosin 0.0043
Further Details:      
 
Domain Number - Region: 1038-1105,1159-1287
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.0157
Family Tricorn protease domain 2 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001651   Gene: ENSMEUG00000001785   Transcript: ENSMEUT00000001811
Sequence length 1479
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7607:27213:51102:-1 gene:ENSMEUG00000001785 transcript:ENSMEUT00000001811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRLQALDRMVCGERGGPEPAGLLDGLLDLLLGLHQELSSAPLRRERNVAHFLSWXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLIMDYYAGGDLLTLLSRFEDRLPPELAQFYLA
EMVLAIHSLHQLGYVHRDVKPDNVLLDTNGHIRLADFGSCLRLNANGMVDSSVAVGTPDY
ISPEILQAMEEGKGHYGPQCDWWSLGVCMYELLFGETPFYAESLVETYGKIMNYEDHLQF
PPDVPEVSESARDLIRKLLCRQEERLGRGGLDDFRGHPFFEGVDWERLPSSTAPYIPELQ
GPVDTSNFDVDDDTLNHPXXXXXXXXXXXXXXXXXXXXXXXXXXXPSSDRSPDLQASSLE
QRMQTLEQEKAELSQKLQDALQRASPGLLELEQLRKEVETLQKKLADLSEARAQMQAQAQ
ELIISEEKQKELQKRLQEAEEAAGAARSRAQALGQQLEDAREAQTQLEAKVTTLSSEVSR
LRKQRDRSRETERSRVKSIHPPPETNGSPHEPHQGADQQEPLRSQGPKGKDELCRLQEEN
RRLTQEQEQLSGELERERQIKKQLEGERQERESAWEAQISDILTWVNDEKVSRGYLQALA
TKMAEELEVLRTAGTQTLPARPLDHQWKARRLQKMEASAKLELQSALEAEIRAKQSLQEE
LARVQEALRLAESLLKESEKRNQALQQELSTLQEELKARGLGDCKPFNSLIPFLSFRSSE
KDASKEPSSSDVPDSRRPGAEAELRPEGRRSMRLGPGSHILRPRSFPSPTKCLRCTSLML
GLSRQGLACEACSYFCHSACAPLAPPCPVPPELLRTVLGVNAETGIGTAYEGFLSVPRPS
GVRRGWQRVFAVLSDLRLLLFDAPDPKLCPASNALLQTLDLRDPQFSAAPVLASDVIHAQ
SRDLPRIFRVTASQLTVPPTLCSVLLLADSEAERARWLQVLGELHRLLMDMRPRPLPVYT
LKEAYDNGLPLLPHALCATIIDQERLALGTEEGLYVIHLHTNDIFQVGECKRVQRLAVSQ
PAGLLAVLCGRGPSVRLFALDDLESSEAVGAKIAESRGCQSLAAGRVLQASTAVLCVAVK
RQVLCYQLGPGPGPWHRRIRELQAPGPVQSLALVGDRLCVGAAGTFALYPLLNEAAPLVL
GSGLVAEGPGPSEALGAVELSLSEFLLLLSTAGIYVDRAGKKSRSQELLWPVAPIGWGYS
APYLTVFSENAIDVFDVRKAEWVQSVPLKKVRPLNPEGSLCLYGSEKVRLTYLRNRLAEK
DEFDIPDQTDNSRRQLFRTKSKRRFFFRVSEEQRQQQRREMLKDPVIRSKLISPPTNFSH
LAHMGPGDGKVPEDKGRGGGRSHGPTRPHNLSEAPRLPASMGSEVLIPDTDSVRRKPRTS
LSSESVSCSQGPLSPTVSLSQISDRPRSLPPASESENPH
Download sequence
Identical sequences ENSMEUP00000001651 ENSMEUP00000001651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]