SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001783 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001783
Domain Number 1 Region: 51-251
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.86e-67
Family Arfaptin, Rac-binding fragment 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001783   Gene: ENSMEUG00000001943   Transcript: ENSMEUT00000001954
Sequence length 444
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_23:5816:45486:-1 gene:ENSMEUG00000001943 transcript:ENSMEUT00000001954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGHKCSYSRELYDQYAQSQDKSVVNKMQQKYWKTKQALIKATGKKEDEHVVASDADLDA
KLELFHSIQRTCMELLKAIELYQKRICFLSQEESELGRFLRSQGSQDKTRAGKMMQATGK
ALCFSSQQRLALRSPLCRLYQEVETFRYRAISDTWLTVNRMEQYRTEYRGALLWMKDVSQ
ELDPDLFKQMEKFRKVQAQVRHAKLNFDQLKNDVCQKVDLLGASRCNLLSHVLTTYQTTL
LHFWEKTSHTMAAIHESFKGYQPYEFTMLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLGSF
PGVSESDMADKDDMQLLNEILNASSLDEGDFSKEWTAVFGSEQTPEPRATSAPGEPEPGP
PPSSSFLPSQLLDKNMQDLQSSLQ
Download sequence
Identical sequences ENSMEUP00000001783 ENSMEUP00000001783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]