SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000001986 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000001986
Domain Number 1 Region: 12-202
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-43
Family BAR domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000001986   Gene: ENSMEUG00000002173   Transcript: ENSMEUT00000002180
Sequence length 202
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6504:16640:37513:-1 gene:ENSMEUG00000002173 transcript:ENSMEUT00000002180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPFKIGQPKKQIVPKTVERDFEREYGKLQQLEDQTKKLQKDLKKSTDADLAMSKSAVKIS
SDLLSNPLCEQDQEFLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNM
AVKRREQALQDYKRLQSKVEKYEEKEKTGPVLAKLHQVREELRPVKDDFEAKNRQLLEEM
PRFYSSRLDYFQPSFESLIRAQ
Download sequence
Identical sequences ENSMEUP00000001986 ENSMEUP00000001986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]