SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002009 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002009
Domain Number 1 Region: 1464-1570
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000508
Further Details:      
 
Domain Number 2 Region: 1571-1685
Classification Level Classification E-value
Superfamily C-type lectin-like 2.35e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000536
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002009   Gene: ENSMEUG00000002175   Transcript: ENSMEUT00000002207
Sequence length 1687
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7720:7372:122511:-1 gene:ENSMEUG00000002175 transcript:ENSMEUT00000002207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSLVRMALMKCCFRWLKQFVMGPWSLVIILFSIQQVYGGGKKYSGLCGGRDCSVCQCFPE
KGSRGQPGHLGPQGPIGDLGPPGSIGLPGEKGMKGDSGPPGPVGDKGDKGPTGVPGFPGL
DGIPXXXGPPGSRGKPGIDGRSGSRGDPGFQGERGAPGREGPAXXXXXXXXXXXXXXXXX
XXXXXXGDRGDPGPPGLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMKGMPGVTGPSGPYGAKGEPGFGVKGE
KGISGFPGPQGGPGSHGLPGFPGVKXXXXXXXXXXXXXXXXXXGDPGDRGKPGPPGVLVT
SPVPSKGPPGDPGFPGHYGEKGSVGLPGPSGPSGRPGEDRIXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXNEGLCSCCPGPMGLPGAPGLHGLQGRKGEMGLPGRVGEKGDSGFPGAQGSPGP
PGIPGTSGLPGPKGEKGDMVIARIKGRKGEKGHAGLPGYPGLEGIPGQNGLYGERGEPGL
PGSCGGAIPGAEGSPGAPGSPGRMGPMGPPGLGFPGPEGVRGGPGSPGHPGVRGAAGSKG
QKXXXXXXXXXXXXXXXXXXXXXXXXPKGFPGPPWGAGLPGFDGWKGKQGKPGISEIPGP
PGLRGDPGESGPEGEKGSAPIGPPGPPGSPGINGQKGVPGDSVYGLPGLPGNRGPPGLPG
LKGLRGDPGFPGATGTTGVPGFPGTKGLPGREGNSGPPGNPGLPGHGCQGFPGLPGQPGL
PGSPGIPGFDGLKGHQGDRGPPGPDGMKGLPGTPGLPGLPGPPGPQGDPGHCGYNGLLGY
PGPKGAQGLPGIPGFPGGRGRKGEIGLPGRKGDPGEEGHCGLPGEPGEPGSKGEKGYPGD
QGDISIIPRKGEKGDPGPPGIYGFPGEKGDKGTPGIPGIKGFPGRDGLPGFERGEPGNNG
HPGLPGPPGVPGSGPRGMIGFPGIPGDQGELGLPGLPGLPGRHGARGPKGNQGDTARPLG
PPGPKGDPGIPGCPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPGLPGLKG
CPGEAGDPGPPGVRGDPGPPGPKGIKGSSGLPGLDGLPGLKGQKGSKGSSGLNEVGPPGP
MGLPGLKGKKGEPGRPGASCPGPSGDRGPLGPPGRPGLPGLPGAVGKTPEVEILPPGPLG
DQGSPGPDGPRGSPGPPGVPCSCDLLKGDPGDHGHPGPPGPQGLPGPPGGKGFPGCEGKD
GQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPQIPGL
PGPGPRGPEGKIGHPGQQGPPGPGRKGERGVDGQRGLDGGPGPPGLSGHKGDPGEECGGA
PGPPGPIGDPGPKGSGTRYLNGFLLVLHSQTDKEPSCPEGMPRLWTGYSLLYLEGQEKAH
NQDLGHAGSCLPMFSTMPFAYCNINQVCHYARRNDKSYWLSSAAPLPMMPLSEDEIQAYI
SRCAVCEAPAQALAVHSQDEAIPPCPPSWRSLWIGYSFLMHTGAGDQGGGQSLTSPGSCL
EDFRAAPFIECQGRQGTCHFFANEYSFWLTTVPPDLPLSSAPLPDTLKQEQIQRQKTSRC
QVCMKYS
Download sequence
Identical sequences ENSMEUP00000002009 ENSMEUP00000002009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]