SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002014 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002014
Domain Number 1 Region: 114-176
Classification Level Classification E-value
Superfamily PH domain-like 3.42e-17
Family Phosphotyrosine-binding domain (PTB) 0.0065
Further Details:      
 
Domain Number 2 Region: 30-78
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000533
Family Phosphotyrosine-binding domain (PTB) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002014   Gene: ENSMEUG00000002206   Transcript: ENSMEUT00000002212
Sequence length 308
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6435:782:32572:1 gene:ENSMEUG00000002206 transcript:ENSMEUT00000002212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALKSAGRALIRSPSIAKQTWGGSGRHRKLPENWTDTRETLLEGMLFNLKYLGMTLVEQ
PKGEELSAAAVKRIVATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISYCT
ADKMHDKVFAYIAQNQQSESLECHAFLCSKRKMAQAVTLTVAQAFKVAFEFWQVSKEXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXITTGNLLDLEETAKAPLSTVSANATNLDEVGKPE
PLANNNVVWELDDGLDEAFSRLAQSRTNPQVLDIGLTAQDIQYAQCLSPVDWDKPDLGTS
EQDDLFGF
Download sequence
Identical sequences ENSMEUP00000002014 ENSMEUP00000002014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]