SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002040 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002040
Domain Number 1 Region: 157-219
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000068
Family PX domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002040
Domain Number - Region: 344-522
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000204
Family IMD domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002040   Gene: ENSMEUG00000002228   Transcript: ENSMEUT00000002239
Sequence length 524
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_339:495:21336:1 gene:ENSMEUG00000002228 transcript:ENSMEUT00000002239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGGGGCSASERLPPPFPIPEPGPEGAAGGGGSELEAGDSDAEGEDIFTGAAVVNKSM
SLKRASPPPMTSNSKENGVHGELDQEQQDLFAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGMNAYVAYKVTTQTSLPVFRS
KQFSVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPRAVGTQTLSGAGLLKMFNKATDAVSKM
TIKMNESDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLALNTAQFAKSLAMLGSSE
DNTALSRALSQLAEVEEKIEQLHQEQASNDFFLLAELLSDYIRLLAIVRGAFDHRMKTWQ
RWQDAQTMLQKKRETEARLLWANKPDKLQQAKDEITEWESRVTQYERDFERISTVVRKEV
IRFEKEKSKDFRNHVIKYLETLLYSQQQLVKYWEAFLPEAKAIS
Download sequence
Identical sequences ENSMEUP00000002040 ENSMEUP00000002040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]