SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002122 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002122
Domain Number 1 Region: 34-197
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.32e-23
Family Protein kinases, catalytic subunit 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002122   Gene: ENSMEUG00000002329   Transcript: ENSMEUT00000002330
Sequence length 251
Comment pep:novel scaffold:Meug_1.0:Scaffold37485:4188:5274:-1 gene:ENSMEUG00000002329 transcript:ENSMEUT00000002330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAAAAETEGDGAAAETADLAADQERSSDFLRGLELVKQGAEARVYRGRFLGRAAVVKER
FPKRYRHPALDTRLSRRRTVQEARALLRCRRAGILAPVVYFVDYASNCLYLEDIEESLTV
RDYIQSIQGTETDAENLPLLARKMGKVLAHMHDEDVIHGDLTTSNMLLKKPAEQLSLVLI
DFGLSFISALAEDKGVDLYVLEKAFLSTHPNTESLYQDLLKSYSSESKKSGPVLKKLDEV
RLRGRKRSMVG
Download sequence
Identical sequences ENSMEUP00000002122 ENSMEUP00000002122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]