SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002148 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002148
Domain Number 1 Region: 2096-2191
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-32
Family Link domain 0.00015
Further Details:      
 
Domain Number 2 Region: 480-619
Classification Level Classification E-value
Superfamily FAS1 domain 1.06e-26
Family FAS1 domain 0.0024
Further Details:      
 
Domain Number 3 Region: 948-1095
Classification Level Classification E-value
Superfamily FAS1 domain 6.8e-26
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1703-1823
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-19
Family FAS1 domain 0.0089
Further Details:      
 
Domain Number 5 Region: 1622-1692
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000942
Family FAS1 domain 0.0075
Further Details:      
 
Domain Number 6 Region: 1102-1233
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000131
Family FAS1 domain 0.0078
Further Details:      
 
Domain Number 7 Region: 2187-2305
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000209
Family FAS1 domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002148
Domain Number - Region: 840-963
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 1982-2019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Domain Number - Region: 2028-2062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00356
Family EGF-like domain of nidogen-1 0.089
Further Details:      
 
Domain Number - Region: 802-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 443-470
Classification Level Classification E-value
Superfamily FAS1 domain 0.0275
Family FAS1 domain 0.011
Further Details:      
 
Domain Number - Region: 246-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family EGF-type module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002148   Gene: ENSMEUG00000002309   Transcript: ENSMEUT00000002359
Sequence length 2427
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_188:201:55428:1 gene:ENSMEUG00000002309 transcript:ENSMEUT00000002359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQSKHCNMKTKFLTNSQCTSCAAYKSQSCPPGWQEEKDPQECSYTVTLGENHILMSGCSQ
TCWKEVEEKACCPGYWGSQCYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXCACVHGVCKSGPLGDGSCLCFSGYTGPRCDQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHGDGKF
CQPVDPCTSNYGGCPSNTTQCLYVRPGESTCTCKPGLVRISFNISEGLHIFHHPPCRYFF
CDSSATCKVDEKGKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXYKYKDQPSSTYNIIQANLPASNGIFHLVSNIRKQPSSAFIPGDPEK
SIGKILASMDVFSRFETILENCGLPSILEGPGPFTVFAPSNSAVDSLRDGRLIYLFTEGI
SKLQELVKYHIYISAGLTVDKLIFLKQIQTMANQVLLTNITEEGRILLGSPGIPLKSMDI
VASNGIIHLLDGILLPPSILPILPHRCNENQYKIVMXXXXXXXXXXXXXXXXXXXXXNIF
LKECVYIHDPDGLNMMKKGCARYCNQTVVKLGCCKGFFGPECSQCPGGFSNPCYGKGNCS
DGIQGNGACICQKAYKGIACHVCADPNRHGEQCEEECGCVHGICDNRPGSGGICQRDTCT
KGFTGPFCNESLADCGPTGLAQHCHPRARCVILEGRAMCVCPPGFEGDGFSCEVKHPCDQ
PDRGGCSENAQCVRGVSEPQRCICNKGWKGDGKMCVAINPCELETRGGCHAEARCNYVGP
GQSSCTCKPGFAGDGYECSFINPCLKTHNGGCHVLATCRPQGDGERPLCLCPDGYGGDGF
TCYGTIMEELKRNDHFAEFYQWIKRAGFALPTRGNFTALVPSQSAIQNLSPEDKAFWLQQ
QQLLHLLRAHFLPGALTTRQLSGLFGQEVTTLNPPTHWQISNSSGKITIRNVSVAVADIL
ATNGVLHILSKVLLPSRMDAPAPRLSLRQQLDAIPSFSIFKELLLQYQLLAQIEAAAAYT
LFVPTNDSVEDYCLKANLSTLDLETVMRHVLVGEALTPDAMRPGMHRNSLLGASYELIFY
VRQGELPLVNRVPVVGPTLKPQRGVVLGLGGVLAERPNICPRSHEAAVRKKCGSCERRYR
CPSGYRIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXELLRDKDAAFFSHYFMXXXXXXXXXXXXXXXXXXXXXXXXXXKELATFSIHRQ
LLFRYHTVGCRRLLTQDLLEAGYVTTLSGHKLHFTQHEGNIYINEYAQVVTEDQIGVNGV
LHFIDKLLLPPEVVHWTNLIPKTAKVLPMFHDKSHQPFTVLWPTDEALRALSPERQAWLY
HEDHREKLAAILRGHIIRNVKALASDIPHLGELRTMHGSPISFSCSKTLPGDLLVGEGEA
RIVQRHMEFLGGIAYGINQLLEPAGLGSRCDHGCRRRCFTVTWKPACCQGHYGIDCQVCP
GGPENPCSGNGVCSEGMTGTGACKCNKGFNGTACELCAAGAFGPRCQACQCTDHGQCDDG
ISGSGFCFCNEGWSGQRCETKLDVQPVCSPPCDLHAVCREDNICECNLDYEGDGHKCTVI
DHCQNGHGGCSQHANCSQQGVVVTCTCHPDYEGDGVFCQARDRCADGQNGGCSEHAECIS
TGPNTRRCECRAGYVGNGLQCLVEAVPPEDRCLETPGPCHPEAICTDLHFQEKRAGVFHL
QSREGKYRLTFKEAEEQCAAQGAVLASLDQLSAAQQLGFHLCLMGWLSNGTAAYPSVYPS
ANCDSNHVGIVIHGAQSNSNERWDAYCYRVHDVMCQCRHGFVGDGNTVCNGKLLDVLAAN
ANFSTFYGLLLDYANTTQHGLEFLGFLSDELTFKTLFVPINSGFEDNVTLSWKDLELHAS
NVTFLSLNLSQSTILPAHSGLSFISNSSAGNSTGPGTTGTVLXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAEDDEDDFSPWQEGPSPPLISVPNPTFDG
HDTFYEPFDDSLIEKEFPDTHRILEEE
Download sequence
Identical sequences ENSMEUP00000002148 ENSMEUP00000002148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]