SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002306 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002306
Domain Number 1 Region: 322-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-29
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002306
Domain Number - Region: 491-580
Classification Level Classification E-value
Superfamily PH domain-like 0.000134
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002306   Gene: ENSMEUG00000002515   Transcript: ENSMEUT00000002528
Sequence length 1303
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8136:264:62822:-1 gene:ENSMEUG00000002515 transcript:ENSMEUT00000002528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEELDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDTDKPAEPVKRSPLRQET
NIANFSYRFSMYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQATETKAALK
LPASRHTLKHGTPKGLSSSSNRITKPSPANYSLDDITAQLEQASLSMDEAAQQSIMEDSK
PTVISQHRRTASAGTVSDAEGRSISNSSRSSITSAASSMDSLDIDKMTRPQELDLTHQGQ
PVTEHFNSVGCPSKQAKCHIDFMEEETELTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLVIRVHMSDDSSKTMMVDERQTVRQVLDNLMDKSHCGY
SLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFVERIEKYALFKNPQNYLL
GKKETSEMADRNKEVLLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVSRDLVCFLQLDHINVYYGQDYRNKYKAPTDYCLALKHPQIQKKSQYIKYLCCD
DVRTLHQWVNGIRIAKYGKQLYLNYQEALKRTEAAYDWTSLSSSSIKSGSSSSSIPESQS
NHSNQSDSGVSDTQPTGHIRSQSIVSSIFSEAWKRGTQLEESSKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE
IPSVFSGNTPPKVAVVNPQPQPWSKTSVKKAPPPTRPKRNDSTRLTQAETTEQQVTATVI
PQVPTSPKSSLSVQPGFLADLNRTLQRKSITRHGSLSSSRISRAEPTATMDDMALPPPPP
ELLSDQQKIGYGGSHISGYATLRRGPPPAPPKRDQNTKLSRDW
Download sequence
Identical sequences ENSMEUP00000002306 ENSMEUP00000002306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]