SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002318 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002318
Domain Number 1 Region: 3031-3135
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 5.55e-28
Family Colipase-binding domain 0.072
Further Details:      
 
Domain Number 2 Region: 322-458
Classification Level Classification E-value
Superfamily C-type lectin-like 1.63e-27
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1009-1132
Classification Level Classification E-value
Superfamily PKD domain 5.49e-22
Family PKD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1944-2066
Classification Level Classification E-value
Superfamily PKD domain 6.51e-20
Family PKD domain 0.0022
Further Details:      
 
Domain Number 5 Region: 1607-1722
Classification Level Classification E-value
Superfamily PKD domain 7.06e-20
Family PKD domain 0.0053
Further Details:      
 
Domain Number 6 Region: 1-87
Classification Level Classification E-value
Superfamily L domain-like 1.09e-19
Family Ngr ectodomain-like 0.0057
Further Details:      
 
Domain Number 7 Region: 1394-1465
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000157
Family PKD domain 0.0037
Further Details:      
 
Domain Number 8 Region: 1231-1300
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000051
Family PKD domain 0.0047
Further Details:      
 
Domain Number 9 Region: 193-280
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000275
Family PKD domain 0.0002
Further Details:      
 
Domain Number 10 Region: 1328-1381
Classification Level Classification E-value
Superfamily PKD domain 0.00000000017
Family PKD domain 0.0032
Further Details:      
 
Domain Number 11 Region: 1809-1890
Classification Level Classification E-value
Superfamily PKD domain 0.000000000209
Family PKD domain 0.0086
Further Details:      
 
Domain Number 12 Region: 1715-1807
Classification Level Classification E-value
Superfamily PKD domain 0.000000000262
Family PKD domain 0.0057
Further Details:      
 
Domain Number 13 Region: 1469-1550
Classification Level Classification E-value
Superfamily PKD domain 0.00000000051
Family PKD domain 0.011
Further Details:      
 
Domain Number 14 Region: 1145-1216
Classification Level Classification E-value
Superfamily PKD domain 0.00000000085
Family PKD domain 0.0043
Further Details:      
 
Domain Number 15 Region: 1566-1631
Classification Level Classification E-value
Superfamily PKD domain 0.0000275
Family PKD domain 0.016
Further Details:      
 
Domain Number 16 Region: 835-936
Classification Level Classification E-value
Superfamily PKD domain 0.0000576
Family PKD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002318   Gene: ENSMEUG00000002502   Transcript: ENSMEUT00000002544
Sequence length 4230
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_650:99204:146956:-1 gene:ENSMEUG00000002502 transcript:ENSMEUT00000002544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DISDNFISTLETEFFENLSALVQLDISNNKISTLEEGIFANLFNLSEINLSVNPFVCDCN
LSWFPIWVDEQKVSVVQLREARCAEPPHLADVPILSISFSDDTCDEESIACLQDNSSSTV
TLVTFSAMHDGVLAQNFCSAFCFSLGQEYGGLSEEGHCFCGKAHSPNASSSCLLFCPGFT
ASPAACRVPVILHNVFPASLEASLLGPGVPQPAGHPVAFNVSTPLPANNLRWDFGDGAGI
DTGPASSHRFILPGHYNVTAVLTWEARTASLWTEVQVEAVPTELELLCPSWLRNNESLEF
GIRNRGGTGLSAIYRIMAESEQPARVVHPLCPSDTEIFPGNGHCYRLVVEKASWLQAQRH
CQAWGRGDLAIVGSPEIQHFLVSQVTRSLDVWIGFTALTGPGVPPHGEAFSLESCQNWLP
GEPHPANAEHCVRLGPAGQCNTDLCTATHSYVCEFQPTGAVSNAENFFVGDASLDLPGPM
VPLEEQDVLSAPGHETVEVMIFPGLVLQRKGFLTAAEFGTQDLTEPVQMRLQVYRPVGGG
IPENTSQLSCPPLDNQTWVPLECLAGEHWCPLANMCLPLDSPCSISCVNDSSSERQPLVH
YSLWREFLFSIPAGPSLQYSVSFSSKNLSLLPGDLFGIQHDAGPGALLHCLPRHEALTHL
HLQSECLSANVSTWLHRLPAHLGCTSNGTTCALHLLFATEQVTPLLGQPSNPGLQHLGHY
VVRASVDNGVSSHNLSCSFDVLSPVVGLRVIHPAPQSGRFYVSTNWTYLVLKISSGVNST
ASRLGSNQSVPFEASCPPGVAQLTTDCIRETNDTWFALFELDGLGDDESLVEIVAENHVS
RENISIQVKAEEPIRGLSATPNPQTRVLQSTLVRYSPVVDAGSDVVFKWTIDDKQSLTFY
NIVFNVIYQSAAVFKLSLTASNHVSNVTVNYNVTVEKMNKMRDLVVSEVPAVIPQNTTLQ
LGASVQVDSAVEVAFLWTFGDGEQESGHFKPPYNESFLVPEVSQVLIEHNVTHTYHVPGD
YNLTVFVFNTFENLTQQVPLSVRASLPHVTVETDSGALVVGRPITFTPCPLPSPAGVLYT
WDFGDGSPAVLKSDPMVSHTYVSRGVYNISLMVNNTVSSVRAHLFVRVFEEIQGLRVSPV
AATEKGMAVTVNASVEAGDNITWTFDMGDGTVLTGPEASVQHVYLQDENCTIKVTAANPV
SSLSQVLPIHIFVLEVLKIEPSSCIPEQPEVQLTAHVTGDYTHYVFDWTFGDGSSNATVH
GHPTVTHNFTRSGIFPLSLVLSSLVNKAHYFTSVCVEPEVSNITLRPERQFVKLGEEAKL
EVQAFPPFFYRYSWDFGANDSARSGGTEVSYAYKVPGIYLVTVTVSNNVSSDNDTAFVEV
QEPMGITSIEVNSSHVLELNQPYLFSVMGNGSPASYSWDLGDGQRQEGLQVIHAYNHTGS
YTVSVVGWNEVSHSKAQLNVTVKRRVQGLSVNASRTVVPLNGSVSFSTTLQAGSDVHYSW
VLCDRCTPIPGSSTISYTFRSVGTFNIIVTAENEVSSLQDSIFIYVLQQIEGLQMLGGGD
GGCFSTNHTLQLQAAVRDGTNISYSWTVQRESVLIHTAQGKVFPLIVLEAGTYHVQLKAI
NMLGSATVNRTLEFVESVGQLAVSASPNPAAVNTSVNISAVLSSGTSITYAWFLQEGVSV
EATEPFVIHSFSSPGLWTVTVTAKNQLGSVNAITHVDVQEPVAGLTAGCGELGSSFVVSG
SVVHFWGRLEHGSNVSWSWELPDSTRSGQRMASVFPNAGAFSIRLNASNAVSWTTASCNI
TVEDPIQGLELWASSRVVEPGERVHFSIRLTLGSNVNYHLLISGGVTTALDGPSFSHSFP
RVGDYMVTVQAENHVSWEQVQVRISVLEAIGGLQIVGCCELGIPTGGEKNFTARVQKGSR
VSYAWYFSLEKVQGDSLVILSGREVAYTPVAAGRLEIHVRAFNDLGSVNLTKTIEVQDLI
QAVALRPGNCFTNRSAQFEAATTPSPRSVFYRWDFGDGSQIQETSTPLSNHTYLLPGDYN
VKVNASNLVSFLVAKATVTVRVLECEEPEVEVALPTQVVMRRSQRSYLEAHINLRGCVTY
QTEYHWQVYRAASCLHYKPSAHVPLPGVDVSRPQLVVPRLALAVGDYCFVFVVSFGDTPL
SRSIQANVTVTPGRLVPIIEGGSYRVWSNTRDLVLDGGKSYDPNLEDGDQTLLSFHWACV
XXXXNHPGGCPLNFGPRGSSLITIPKERLEAGVEYTFNLTVWKAGRKEEVTNQTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXWRDTEDEDAPLVYSLLLRRCRQGYCEEFCIYKGSLSAYGAVLPP
GFKTHFTVDLSVVVQDQLGAAVVALNRSLLITLPEPSASFHCLTHWLYSLTETVLPGLVK
QADPQHVIEYSLALITVLNEYEQDIEEEASHERHLRALMRRNITEILVSLRVNTVDDIQQ
ISAALAQCTVASKEFVCYPCLKKTLNKLENMMAILQNETMQGTVTPTAIADNILNITGDL
IHLVNSNTQGLESTELCNKPHTFLVAFKAYNLSSDLMRILMKSRVLNEEPLTLAGEEIVA
RGKRSDPFSLLCYENTSDCQFSIPAAFNSTFSDLTDVIQLIFLVDSNPFPFGYISNYTVS
TKVASMAFQTQAGAQIPIEQLGSEKAITVKVSNNTSGGGGDRILSTDSAIIQPCTSVSAI
IDPQNHNPEAGLHFQLNYTVLNERYLSEEPEPFLAVYLHSAPQPNEYNCTASKKIGLKAL
TGGDHRPYTFFISPGTDDTTASYYLNMTSHFRWSEVEVTVGLYTSLCQYFSEKEMIWKTE
GIVPLEETSPSQAVCLTRHLTAFGASLFVPPGSIKFIIPDPAPGINYIVLLTCAVCLVTY
AVTALIVRKLDLIDVSRVSIIPFCGKNGRFKYEILVKTGWGQGSGTTAHVGITLYGADGR
SGHRHLDAESAFHRNSLDIFQIATQRSLGSVWKIRVWHDNKGLSPAWFLQHIIVRDLQTG
RSAFFLVNDWLSVETEDNGGLVEKEVLAANDATLRRFPRLLTAELQRGFFEKHIWLSLWD
RPPRSRFTRVQRATCCTLLICLFLGANAVWYGVVGDVNHSNMPMSSLIPLSVDTVAVGLV
SSVVVYPLYLVILFLFRMSRSKVSVSPDRSPGGQQVLDIENYLETSVLDSSFLTLSGLHT
EQAFSGQTKTDLFLDDSKSLMHWQSSDGTLSWPDLLSDPSIMGNTLQRLVRARAGPGVME
EDGLSLGSPPSQTKYFSTSDEDLIRQILTEGASTIAPARDTHLETDLLTGLXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLLEALYFSLVAKRLHPEEDDT
LVECPAVEPVCERIPRVRPPQGFALFQAKEEARKVKLLHRMLKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDEFWVWMSRVLLPYVHGNQSGLELGPPRL
RQVRLQEALCPDALGTVRKMCTTSSSFSTKDYEVGWESPNGTRAWAYSAPDLAGVWYWGY
FSVYDSGGYIQELGVSLEESRELLGFLQRHNWIDNMSRAVFVELTQYSPAVGLHAAVTLR
LEFPVSGRALTAISVRPFPLQRLSAGVTLQLLMMVFLMLFVVYFVVTEALAMQKEGQAYL
VRARAWGQWLLILLTTATVLIHLSQLSLADQQWGRYLKRRPHHFTSFYQVAQLSSAFASL
AASLLFLLMIKAAQQLRFIRQWSVFGKTLYRSVRELVAAGLALLVLAIAYTQLGFMLFSS
CSDSLRSMGWDLFLLCPAGGDPHLCPSEPWRLSPLLCTSLMVLQLWGALRLGAVVLRRRY
HALRGELYRPAWEPQDYEMVELFLRRLRLWMGFSKVKEFRHKVRFEGMEPLPSRSSSDSK
SSQDVSPPSAGSDTSRPSTSSSQLDGMSVLMGRAGPRSEPEPSRLLSVFEALLAQFDRLN
QATEDVYQLEQRLQGLQGRRSGGHLASPPWVPGPPMPSPSPGPSLGTQTTLPARIARASR
GIGVATAQSSSSPLVRASIRAKNKIHPSLT
Download sequence
Identical sequences ENSMEUP00000002318 ENSMEUP00000002318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]