SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002380 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002380
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.3e-39
Family BAR domain 0.000000108
Further Details:      
 
Domain Number 2 Region: 277-372
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00000237
Further Details:      
 
Domain Number 3 Region: 533-611
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000143
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002380   Gene: ENSMEUG00000002591   Transcript: ENSMEUT00000002609
Sequence length 612
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7642:72:32053:1 gene:ENSMEUG00000002591 transcript:ENSMEUT00000002609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGIDKLPIEETLEDSPQTRSLLGVFEEDAAAISNYMNQLYQAMRRIYDAQNELSAATHLT
SKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPISQFKER
DLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRREMD
CEVETMQQTIEDLEVASDPLYLPDPDITKFPVHRNLTRKAGYLNARNKTGLVSSTWDRQF
YFTQGGNLMNQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESKK
DYEEWICTINNISKQIYLSENPEEIAARVNQSALEAVTPSPSFQQRHESLRPNPQTRPPT
ARTSSSGSLGSESATLATLSLDSLVAPDTPIQFDIISPVSEDQPGQAKNSGQGGKRTNPF
GESGGRSKPETEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIFRMTE
SHLLVTCDCLKLIDPQTQVTRLRFPLPNVVLYATHQESKRLFGFVLRTSGGRVESHPTSV
CYIFESNNEGEK
Download sequence
Identical sequences ENSMEUP00000002380 ENSMEUP00000002380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]