SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002613 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002613
Domain Number 1 Region: 549-812
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-79
Family Protein kinases, catalytic subunit 0.000021
Further Details:      
 
Domain Number 2 Region: 393-504
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-31
Family Pleckstrin-homology domain (PH domain) 0.00000138
Further Details:      
 
Domain Number 3 Region: 110-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 
Domain Number 4 Region: 252-309
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.07e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002613   Gene: ENSMEUG00000002859   Transcript: ENSMEUT00000002870
Sequence length 878
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2072:350:24677:-1 gene:ENSMEUG00000002859 transcript:ENSMEUT00000002870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASSAPAGLPLSPGTGSPRGPEPPQPPPLLLLAPAPGGVSFHIQIGLTREFVLLPAASDL
AHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSAGDIQEGDLVEVVLS
ASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPN
NCSGARKRRLSSTSLASGHSLWLGTSESLPCTPDELSRSSTETFSRRLPSSSSSSSSASY
MGRPIELDKLLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKFNCHKRC
ATRVPNDCLGEALINGDVPMEEASDFGDSDKGSMMDESDDSGFIPGSHAENALSAEEEEE
GEAGKSQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCL
TLFQNNTTNRYYKEIPLSEILAVEPAQNFSLVPPGTNPHCFEIVTANTIYFVGETPILAP
GGPGGGQAAETARGWETAIRQALMPVILQDAPSTPGHTPHRQASLSISVSNSQIQENVDI
ATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSL
RHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILVALRHL
HFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLLN
QGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGAIDLIN
NLLQVKMRKRYSVDKSLSHCWLQDYQTWLDLRELEGKMGERHITHESDDARWEQFAAEHT
LPEGGEPRDGIGGLGRVEQPFSPQDHEVQGLAERVSVL
Download sequence
Identical sequences ENSMEUP00000002613 ENSMEUP00000002613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]