SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002635 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002635
Domain Number 1 Region: 15-55
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000308
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002635   Gene: ENSMEUG00000002882   Transcript: ENSMEUT00000002892
Sequence length 191
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_286:16671:34706:1 gene:ENSMEUG00000002882 transcript:ENSMEUT00000002892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPSNLEGPFEEMALVKAGWLWRQSSILRRWKRNWFALWLDGTLGYYKDDSLEEEEDRVLI
RFNCREVKTGQECPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRIYDPYDDYYQMVPPNAHDATY
IRTGYYGPQYG
Download sequence
Identical sequences ENSMEUP00000002635 ENSMEUP00000002635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]