SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000002912 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000002912
Domain Number 1 Region: 42-807
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.11e-223
Family Motor proteins 0.00000000106
Further Details:      
 
Domain Number 2 Region: 1176-1272
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-26
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 
Domain Number 3 Region: 1355-1474
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1775-1827,1869-1913
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000955
Family Second domain of FERM 0.0093
Further Details:      
 
Domain Number 5 Region: 1137-1177
Classification Level Classification E-value
Superfamily PH domain-like 0.000000134
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 6 Region: 1313-1348
Classification Level Classification E-value
Superfamily PH domain-like 0.00000223
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000002912
Domain Number - Region: 803-891,1179-1204
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0009
Family BAR domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000002912   Gene: ENSMEUG00000003184   Transcript: ENSMEUT00000003201
Sequence length 2023
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5531:718:132575:-1 gene:ENSMEUG00000003184 transcript:ENSMEUT00000003201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLRGTRVWLRENGQHFPSTVNSCAEGVVVFRTDYGQVFTYKQNTITQQKVTAMHPSNEE
GVENMATLIDLHEGSILHNLFQRYQKTQIYTYIGSIVASVNPYKTIPGLYDQSTMEHYSR
HHMGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESGAGKTESTKLILKFLSAISQHSLE
LSIKEKTACVEQAILESSPIMEAFGNAKTVYNNNSSRFXXXXXXXXXXXXXXXXXXXXXX
LLEKNRVVRQNPGERNYHIFYALLEGLGNEEKEEFYLSVPENYHYLNQSGCVADATINDK
ESFKDVITAMEVMQFSKEEVREILRLLAGILHLNIEFITAGGAQVSFKTLGRSAELLGLD
STQLTDALTQRSMILRGEEILTPLNIQQAADSRDSMAMALYSQCFAWIIKKINSRIKGKD
DFKSIGILDIFGFENFEVNHFEQFSINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDID
WIDNGECLDLIEKKLGLLALINEESHFPQATDTTLLEKLHAQHAHNHFYVKPRVAVNNFG
VKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRLDFIYDLFEHVSSRNNQETLKCGSK
HKRPTVSSQFKDSLHSLMATLSTSNPFFVRCIKPNMQKMPDQFDQALVLNQLKYSGMLET
VRIRKAGFPIRRPFQDFCKRYKVLMRNLSLPDVKGKCTXXXXXXXXXXXXXXXXXXXVFL
RESLEQKLEKQREEEVFQAAMVIRAHVLGYLARKQYRKVLYHIVIIQKNYRAFLMRRRFL
GLKRAAVVLQKQRRGQIARRVYKQMLEEKRKKEEQERAEEARRLAELEARQREEQLKQDM
EKQKENKQVEEILRLEKEIQDLQRVKERQELSLTESSLQRLQELRDQELRRLEDEACRAA
QEFLESLNFDEIDECVRNIERSLSVGSGFSAELSELTSDACGEKPNFNFSQPYPEEEVDE
GFEADDDAFKDSPNPSEHGHSDQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLTP
SVHDSASLHNSSSGESTYCMPQNSGDLISPDGDYDYDQDDYEDGALTSGSSVTFSNSHSS
QWSPDYRCSVGTYNSSGAYRFSSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVSL
PYFHSFLYMKGGLMNSWKRRWCVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWK
KRWFVLRQSKLMYFNDSEEKLKGTFEVRTAKEIIDNTSKENGIDIIMADRVFHLIAESPE
DASHWFSVLSQVHASPDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNSFVII
TANRVLHCNADTPEEMHHWITLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKVSSLKLKK
RWFVLTHNSLDYYKSSEKNALKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYR
LYTKLLNEATRWSSAIQNVTETKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYT
HHPLHSPLLPLPYGDINLNLLKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTG
HDLRPLRDELYCQLIKQTNKVPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRI
REQFPGTEMEKYAAFVYESLKKTKCREFVPSRDEIEALINRQEMTSTVYCHGGGSCKITI
NSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGTADKAIESRTIVADVLAKFEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHEAVIRGHYPAPEENLQVLAALRLQ
YLQGDYTMHTAVPALEEVYPLQRLKSRITQSTKTFSPLERMEKRRTSFLEGTLRRSFRTG
SVNRQKIEEQMLDMWIKEEVSSARASVIDKWKKLQGMNQEQAMAKYMALIKEWPGYGSTL
FDVECKEGGFPQELWLGVSAEAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDER
ELLFETSEXXXXXXXXXXXXSMIVKKRYSTRSVSSHGSQGSSR
Download sequence
Identical sequences ENSMEUP00000002912 ENSMEUP00000002912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]