SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003133 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003133
Domain Number 1 Region: 266-437
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000009
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003133   Gene: ENSMEUG00000003430   Transcript: ENSMEUT00000003442
Sequence length 440
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5719:20306:89467:1 gene:ENSMEUG00000003430 transcript:ENSMEUT00000003442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGVGTPKPLPSSGPRSLQDMPHPLAGPSSEEAAGGELTPSPDLQLPRSIADKDLSLP
NGGTPAGTSSPASSSSLLNRLQLDDDLDGETRDLFVTVDDPKKHVCTMETYITYRVTTKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLNAYKKQGMALLSKVGESVKYVTGGYKLRS
RPLEFAAMGEYLDTFALKLGTIDRIAQRIIKEEVEYLVELREYGPVYSTWGGLEVELEEP
LEGVSACIGNCCTALEDLTDDMTEDFLPVLREYILYSESMKNVLKKRDQVQGEYEAKLEA
VALKKEERPKVPADVEKCQDRVECFNADLKADMERWQNNKRQDFRQLLMGMADKNIQYYE
KCLTAWESIIPLLQEKQETK
Download sequence
Identical sequences ENSMEUP00000003133 ENSMEUP00000003133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]