SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003134 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003134
Domain Number 1 Region: 16-132
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-50
Family Dcp1 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003134   Gene: ENSMEUG00000003431   Transcript: ENSMEUT00000003443
Sequence length 612
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5905:590:58993:-1 gene:ENSMEUG00000003431 transcript:ENSMEUT00000003443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLF
VYTRSASPKHGFTIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEEC
QRIAELMKXXXQHDHLKVHHNSKGGIFSKIFNSGVDRERDMLQMLTTDEHIKCKTCSEPK
QITSSSAIYDNPNLIKPIPVKPSEGQHQRVPQQGQNLDPEPQHLSLTTLFGKPDKTTYKE
VTENHNCCHQHQQQQEKPPIRQGVVRSLSYEEPKRNSPTPEKQLCPAIQKLMVRGTDLHP
VSELPETRLCENGSVHPVGEVFTGLFQPVTPHSIGTSHRVQNTSGTQSLLEKLQGTPGSV
SKLESSTTVPTSSTAPIFSRSTTPAAPAAQIKSIGQPQLVYFNGCLPPQTLGPQTLRKEE
PKVSRETLPLSGNQTSSSGVISPQELLKKLQIVQQEQQLHSSNRPALAAKFPVVTQNART
LKPLEDWIDKTSSAEKQTSLFQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDDNFLNIINEAYLF
SVTQAAMKKTTM
Download sequence
Identical sequences ENSMEUP00000003134 ENSMEUP00000003134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]