SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003155 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003155
Domain Number 1 Region: 204-467
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-82
Family Nuclear receptor ligand-binding domain 0.000000000153
Further Details:      
 
Domain Number 2 Region: 124-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000917
Family Nuclear receptor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003155   Gene: ENSMEUG00000003456   Transcript: ENSMEUT00000003466
Sequence length 468
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9162:18043:38036:1 gene:ENSMEUG00000003456 transcript:ENSMEUT00000003466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTESHICPLSPLDDEDLESPLSEEFLQEMGSIQEISPSLGEDSSGAFGFAEYHCLGSG
PGSDGSVITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGFFRRTIRLKLAYDKCDRSCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLEDSEVADLKSLAKRIYEAYLKNFNMNKIKARIILAGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIERMQESIVHVLQLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
Download sequence
Identical sequences ENSMEUP00000003155 ENSMEUP00000003155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]