SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003182 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003182
Domain Number 1 Region: 21-235,477-537,590-617
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.4e-37
Family Regulator of chromosome condensation RCC1 0.0094
Further Details:      
 
Domain Number 2 Region: 1124-1233
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.07e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.028
Further Details:      
 
Domain Number 3 Region: 1080-1121
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000017
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0073
Further Details:      
 
Domain Number 4 Region: 1363-1424,1458-1546
Classification Level Classification E-value
Superfamily VPS9 domain 0.000000000798
Family VPS9 domain 0.028
Further Details:      
 
Domain Number 5 Region: 1597-1638
Classification Level Classification E-value
Superfamily VPS9 domain 0.000000889
Family VPS9 domain 0.014
Further Details:      
 
Domain Number 6 Region: 895-977
Classification Level Classification E-value
Superfamily PH domain-like 0.00000375
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003182   Gene: ENSMEUG00000003466   Transcript: ENSMEUT00000003495
Sequence length 1640
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6263:8484:60210:-1 gene:ENSMEUG00000003466 transcript:ENSMEUT00000003495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEAEGTKERGLVHVWQGLCSITPERLPGWGGKTVLQALRVSHGVLLTEGEVYSFGNLPW
RTEPGEICPRSPLLENALVGHHVITVATGSFHSGAVTENGMVYMWGQNSAGQCAVANQHY
VPEPNPVSISDCETSPLLSVRILQLACGEEHTLALSISREIWAWGTGCQLGLITTTFPVT
KPQKVEHLAGRVVLQVACGDSHSLALVQCLPSQDVKPVPERCNHCSQLLITMTDKEDHVI
ISDSHCCPLGVALSDAPAESHDTITPSTGESLENQGEEKTLKENGLSVASEVDVKNIQPV
NDEATHPEQKISGTTGISILRNVPLYPNNHVEKEHLYKLSDDPLRGHPETSGDGEVAQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
LPSSSASMGPEGLKDSREEQVKLESMQGKKSSSLVDIREEESEGVSRRLSLPGLLSQVSP
RLLRKAARAKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHGDVLPXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCKENGIW
SIAAGQDYSLFLVDTDDFQPGLYYSGRQQPVESDILSTCTKTATXXXXXXLGYISSVTAG
KDSCLALVDKNIMGYIASLHELATTERRFYSKLSDIKSQILRPLLSIENLGSTSTVQLLQ
EVASRFSKLCYLIGQHGASLSSFLHGIKEARSLAILKHASLFLDSYTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXTSPEYPKLQDPSSCYETLALHLGRKRKEAEYTLGFWKTLPKMTDSLRKPERRLICE
SSNRALSLQHAGRFSVNWFILFNDSLVHAQFSTHHIFPLSTLWVEAISEEVGSVNGLKIT
TPEEQFILVSSTPQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGEYKVPNKALNKD
DHYVGYWKEGKMCGQGVYSYANGEVYEGCFQDNMRHGHGLLRSGKLTSSSPSMFIGQWVM
DKKSGYGVFDDITRGEKYMGMWHDDMCQGNGVVVTQFGLYYEGSFSLNKMMGTGILLSED
DTIYEGEFSDDWTLNGKGTLTMPNGDYIEGLFNGEWGSGIKITGTYFKPSLYESEKDRPK
VLKKLGNLAVPADEKWKAVFEECWHQLGCESPGQGEVWKAWDNIAVALTTNRRQHRDXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACDTPLHPLGRLIETLVAVYRMT
YVGVGANRRLLQEAVKEIQSYLKRIFQLVRFLFPDLPEEGSTIPLSVPLPQERKSFCTTK
SDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALENDREEDIYWECVLRLNKQPDT
ALLNFLGVQRKFWPVTLSVFGDSKKVLPTTKDACFASAVECLQQIXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRNLGSEVHLIEDLMDPYLQHGEQ
GIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences ENSMEUP00000003182 ENSMEUP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]