SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000003187 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000003187
Domain Number 1 Region: 245-438
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 125-234
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000481
Family BAR domain 0.022
Further Details:      
 
Domain Number 3 Region: 6-56
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000201
Family BAR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000003187   Gene: ENSMEUG00000003485   Transcript: ENSMEUT00000003501
Sequence length 883
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6500:61659:122261:-1 gene:ENSMEUG00000003485 transcript:ENSMEUT00000003501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMKQLANQTVGRAEKTEVLNEDLLQIERRLDTVRSVCHHSHKRLLACSQCTDDK
RHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVDIPNIQKQRKQLSKLVLDWDSVRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXDQLAADMYNFVAKEGEYARFFVMLLEAQADYHRKALAVLEKALPEIQAHQDKW
TEKPAFGTPLEEHLKRSGRDIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLKAALD
CSTSQLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTKVASVQDSDKKLQDLWSIC
QKLPKPNLANFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKTEGSLADMAAATS
VHVVAVIEPIIQHADWFFPEEVDFNVSGAFVRPASNSNHLAHPGNEYDSGTLERKRPASM
AVMEGDLLKKEGFGVKLMDFQANRRSGTLNRKHTSPAFHPPLPPTEGSTLAPPGSEPPSH
SSGAENSGGGVAFPPSAGLPEPGSSQGNDDSXXXXXXXXXXXXXXXXXXXXSHITTGQNQ
GQAASSSNQLSIGPAQNSAGPSPHTLRRAVKKPAPAPPKPGNPPPGQPGNQGSSGASQQP
PSVSPKPTTRSPSPPNHHTSVAPGQTSTVSQLSTPRRYSSSLSPIQAPNHPPPQPPTQAT
PPPQTKLNSQVLPQPAAALSEHGLEQPAHSPPPTPTPPGTPPLGKQGPALQTSQAQAASN
PEIPQAQHSPPHTGTLPRPRPVPKPRNRPSIPPPPHPPGAHSAGDSGLVNPTQTSSKIVT
DSNSNVAEQLRSLFPEIHMEPASKDLTSRLLLDIENDSESTAL
Download sequence
Identical sequences ENSMEUP00000003187 ENSMEUP00000003187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]